Filter
All 276 Facebook 40LinkedIn 11Contacts 25Addresses 25Real Estate 20Cars 25Business 45Marketing 30Whois 30Donations 25

Steven Weiner Facebook Profiles

Steven Weiner facebook profile
Steven Weiner, steven.weiner.395
Kraft Foods
Steven Weiner facebook profile
Steven Weiner, steven.weiner1
Worked at Electrician
Studied at MATC Milwaukee '73
MATC Milwaukee
Steven Weiner facebook profile
Steven Weiner, steven.weiner.92
Went to Ramapo Senior High School
Ramapo Senior High School
Steven Weiner facebook profile
Steven Weiner, steven.weiner.52
Worked at Alcatel-Lucent
Studied at University of Leeds '80
University of Leeds
Steven Weiner facebook profile
Steven Weiner
Lives in New York, New York
Wellington C. Mepham High School
Steven Weiner facebook profile
Steven Weiner, steven.weiner.921
Lives in Brooklyn, New York
Studied at Kingsborough Community College '71
Kingsborough Community College
Steven Weiner facebook profile
Steven Weiner
Lives in Lake Worth, Florida
Lake Worth, Florida
Steven Weiner facebook profile
Steven Weiner, steven.weiner.3
Lives in Baltimore, Maryland
Studied BFA Photography at Maryland Institute College of Art
Works at Freelance Portrait Photography/ Photo Editing/ Photo Repair
Steven Weiner facebook profile
Steven Weiner, steven.weiner.353
Lives in Weston, Florida
Studied at Life College '93
Chiropractic Physician/Owner at Care Chiropractic Center
Steven Weiner facebook profile
Steven Weiner, steven.weiner.779
Lives in Fort Lauderdale, Florida
Studied Civil & Highway Technology at Wentworth Institute of Technology
Wentworth Institute of Technology
Steven Weiner facebook profile
Steven Weiner, steven.weiner.562
Lives in Ashaway, Rhode Island
Studied Accountancy at Northeasten University
Northeasten University
Steven Weiner facebook profile
Steven Weiner
Former Program Director of CREATE at Arizona Science Center
University of Florida
Steven Weinert facebook profile
Steven Weinert, steven.weinert.5
Lives in Werl
Werkschutz at NSW Sicherheit GmbH
Steven Weiner facebook profile
Steven Weiner, steven.weiner.79
Lives in Paris, Texas
Went to Paris High School, Paris, TX '10
Works at Clayton Homes
Steven Weiner facebook profile
Steven Weiner
Studied at Wayne State University '66
Wayne State University
Steven Weiner facebook profile
Steven Weiner, steven.weiner12
Lives in Toronto, Ontario
Works at Serendipity Homes Inc
Steven Weiner facebook profile
Steven Weiner, steven.weiner.1610
Studied at University of Maryland School of Dentistry '73
President (title) at Steven L. Weiner DDS, PA.
Steven Weiner facebook profile
Steven Weiner, steven.weiner.98
Lives in Charlotte, North Carolina
Charlotte, North Carolina
Steven Weiner facebook profile
Steven Weiner
Tennessee
Steven Weiner facebook profile
Steven Weiner, steven.weiner.334
Worked at Signet Partners
Studied at University of Colorado Boulder
University of Colorado Boulder
Steven Weiner facebook profile
Steven Weiner, steven.weiner.186
Worked at Kaufman Borgeest & Ryan LLP
Studied at St. John's University School of Law '85
St. John's University School of Law
Steven B. Weiner facebook profile
Steven B. Weiner, steven.b.weiner
Lives in Beaverton, Oregon
Beaverton, Oregon
Steven Weiner facebook profile
Steven Weiner, steven.weiner.7796
From West Lafayette, Indiana
Steven Weinert facebook profile
Steven Weinert, steven.weinert.56
Lives in Ewell
Studied at Kingston College
MOT Tester/Technician at Trust Ford
Steven M. Weiner facebook profile
Steven M. Weiner, steven.m.weiner.3
Worked at ////tri countiesw Building and Construction Trades Council
Went to West Islip Senior High School '71
West Islip Senior High School
Steven Weiner facebook profile
Steven Weiner, steven.weiner.9
Lives in Merrick, New York
Merrick, New York
Steven R Weiner-Esquire facebook profile
Steven R Weiner-Esquire, Steven-R-Weiner-Esquire
Lives in Springfield, Massachusetts
Studied at Western New England University
Western New England University
Steven Weiner facebook profile
Steven Weiner
Lives in Philadelphia, Pennsylvania
Philadelphia, Pennsylvania
Steven Weiner facebook profile
Steven Weiner, steven.weiner.54
Lives in Norton, Massachusetts
Went to Sharon High School
Business Owner at Landscape Pros
Steven Weiner facebook profile
Steven Weiner
Worked at Liberty Mutual Insurance
Studied at Harvard University
Harvard University
Steven Weinert facebook profile
Steven Weinert, steven.weinert.716
Lives in Rostock, Germany
Went to Gutenbergschule Rostock
Gutenbergschule Rostock
Steven Weiner facebook profile
Steven Weiner, steven.weiner.969
Lives in Baltimore, Maryland
Studied at University of Maryland
University of Maryland
Steven Weiner facebook profile
Steven Weiner
Worked at Steven R. Weiner, MD, rheumatology
Studied at Columbia University, New York, New York '73
Columbia University, New York, New York
Steven Weinert facebook profile
Steven Weinert, steven.weinert.10
Went to South High School
South High School
Steven Weiner facebook profile
Steven Weiner
Lives in Washington, District of Columbia
Washington, District of Columbia
Steven Weiner facebook profile
Steven Weiner, steven.weiner.129
Lives in Huntingdon Valley, Pennsylvania
Studied at Temple University '74
President (title) at Doline,Weiner & Co,P.C.
Steven Weinert facebook profile
Steven Weinert, Schwippy
Lives in Stöttwang
Studied Nichts Sinnvolles at Berufschule Kaufbeuren
Journeyman at Klemm Wasser und Wärme
Steven Weinert facebook profile
Steven Weinert, steven.weinert1
Lives in Denver, Colorado
Sales at Denver Autos
Steven Weiner facebook profile
Steven Weiner, steven.weiner.31
Lives in Rock Island, Illinois
Went to Rock Island High School
Welder, Assembler, Machine operator at Welding/Machine Shop
Steven Weiner facebook profile
Steven Weiner
Lives in Los Angeles, California
Los Angeles, California

Steven Weiner LinkedIn Profiles

Steven Weiner linkedin profile
Steven Weiner
Associate, Mergers & Acquisitions at J.P. Morgan
Financial Services
San Francisco, California
Steven Weiner linkedin profile
Steven Weiner
Retail
Greater Denver Area
Steven Weiner linkedin profile
Steven Weiner
Chief Patent Officer and Deputy General Counsel at SRI International
Law Practice
Greater Philadelphia Area
Steven Weiner linkedin profile
Steven Weiner
Vice President Sales and Business Development
Broadcast Media
Greater Los Angeles Area
Steven Weiner linkedin profile
Steven Weiner
Hydrogen Safety Panel, Pacific Northwest National Laboratory
Research
Gaithersburg, Maryland
Steven R Weiner linkedin profile
Steven R Weiner
Senior Director, Patient Access at NYU Medical Center
Hospital & Health Care
Greater New York City Area
Steven Weiner linkedin profile
Steven Weiner
Risk and Compliance Analytics Senior Associate at PwC
Accounting
Greater New York City Area
Steven Weiner linkedin profile
Steven Weiner
Support Account Manager, Enterprise Priority Support at AutoDesk
Computer Software
Portland, Oregon Area
Steven Weiner linkedin profile
Steven Weiner
Executive Vice President at Menlo College
Education Management
San Francisco Bay Area
Steven A. Weiner linkedin profile
Steven A. Weiner
Managing Partner at O'Toole Fernandez Weiner VanLieu LLC
Law Practice
Greater New York City Area
Steven R. Weiner M.D., F.A.C.P., F.A.C.R. linkedin profile
Steven R. Weiner M.D., F.A.C.P., F.A.C.R.
Solo Practitioner Rheumatology
Medical Practice
Woodland Hills, California

Steven Weiner addresses, contacts, age, possible relatives

Name
Born in
Address
Contacts
Possible Relatives
Steven R Weiner
Born in 1959
147 Lynnwood Dr,Longmeadow, MA 01106

Former addresses
2 Mattoon St #5, Springfield, MA 01105
567 Dwight St, Holyoke, MA 01040
Mattoon, Springfield, MA 01105
349 Shaker Rd, E Longmeadow, MA 01028
930 Main St #934, Springfield, MA 01103
959 Main St #2979, Springfield, MA 01103
Long, Springfield, MA 01103
40 Pilgrim Rd, East Longmeadow, MA 01028
43 Reed St, Springfield, MA 01109
85 Harmon Ave, Springfield, MA 01118
42 Atwell Ln, Monticello, NY 12701
(413) 567-6251

Former phone numbers
(413) 781-1154
(413) 567-6251
(413) 567-7625
(413) 781-1154


Possible e-mails
bigbrowniz51885@aol.com
Sara Iris Weiner
Sadie Weiner
Howard M Weiner
Beatrice R Weiner
Diane H Weiner
Leo E Weiner

Associated names
Steve Weiner
Steven G Weiner
Born in 1952
40 Seaver St #9,Wellesley, MA 02481

Former addresses
23 Inverness Rd, Wellesley Hills, MA 02481
40 Seaver St #9, Wellesley Hills, MA 02481
32 Beacon St #C, Burlington, MA 01803
23 Inverness Rd, Wellesley, MA 02481
(781) 235-9038

Former phone numbers
(781) 235-9038
Steven Weiner
Born in 1961
905 Tanglewood Cir,Weston, FL 33327

Former addresses
1519 7th Ct, Deerfield Beach, FL 33441
8025 McNab Rd, Tamarac, FL 33321
9822 2nd Ct, Plantation, FL 33324
875 Franklin Rd #1534, Marietta, GA 30067
9800 Sheridan St #304, Pembroke Pines, FL 33024
5271 37th St, Hollywood, FL 33021
3100 Dixie Hwy #91, Boca Raton, FL 33432
549 Central Ave, Cedarhurst, NY 11516
(954) 349-4347

Former phone numbers
(404) 590-0401
(954) 424-0340
(954) 349-4347
(954) 720-1107
(954) 349-0594
(954) 438-1823
(954) 720-1107
Leslie C Weiner
Harry S Wein
Dr Stevenl Weiner

Associated names
Steven L Dr Weiner
Steven Alan Weiner
Born in 1945
4933 Pimlico Dr,Tallahassee, FL 32309

Former addresses
2201 67th Ter, Miramar, FL 33023
(850) 443-7391

Former phone numbers
(954) 894-0676
(954) 981-2745
Steven A Weiner
Born in 1955
11 Palmer St,Hampton, NH 03842

Former addresses
496 Winnacunnet Rd, Hampton, NH 03842
30 Hanscom Ave, Haverhill, MA 01830
(603) 926-1496

Former phone numbers
(603) 926-1496


Possible e-mails
luvddsound@aol.com
Steven D Weiner
Born in 1944
202 Balfield Ter,Cherry Hill, NJ 08003

Former addresses
1609 Mount Pleasant Rd, Havertown, PA 19083
4500 Brigantine Ave #U-1305, Brigantine, NJ 08203
522 Janewing Dr, Norristown, PA 19401
522 Janeway Dr, Norristown, PA 19401
2000 Valley Forge Cir, King Of Prussia, PA 19406
7607 Wyndale Ave, Phila, PA 19151
(610) 279-3134

Former phone numbers
(610) 279-3134
(610) 449-6963
(610) 449-7068
(856) 424-7218
(610) 449-7068


Possible e-mails
bobkacno@aol.com, bobkacno@msn.com
Steven F Weiner
Roseanne A Weiner
Marjorie S Weiner
Melissa Lauren Weiner
Drenie Weiner
Howard Weiner
Beth Mindy Berkowitz
Melissa L Weiner
Max P Weiner

Associated names
Robt Weiner, Robert L Weiner, Steve Weiner
Steven C Weiner
Born in 1970
3 Haskell St,Norton, MA 02766

Former addresses
26 Angell St, Mansfield, MA 02048
708 Elm St, Mansfield, MA 02048
8 Fern Ln #1, Norton, MA 02766
8 Lawndale Rd #1, Mansfield, MA 02048
53 Essex Rd, Sharon, MA 02067
(508) 285-4255

Former phone numbers
(781) 784-2512
(781) 784-2512
(508) 339-7596
(508) 285-4255
(508) 339-7576
Steven R Weiner
Born in 1971
279 PO Box,Jefferson, MA 01522

Former addresses
21 John St #4, Worcester, MA 01609
12 Lamartine St, Worcester, MA 01610
21 John St #2, Worcester, MA 01609
19 Acton St #3, Worcester, MA 01604
3 Henry Ter #4B, Worcester, MA 01607
26 Channing St, Worcester, MA 01605
813 PO Box, Worcester, MA 01613
30512 PO Box, Worcester, MA 01603
9 Quinapoxet St, Jefferson, MA 01522
21 John St, Worcester, MA 01609
(774) 364-1847

Former phone numbers
(508) 754-4159
(508) 829-7312


Possible e-mails
densteve@ix.netcom.com, mrperdue69@hotmail.com, sweiner9@hotmail.com
Stan Weiner
Steven J Weiner
Born in 1949
26 River St,Catskill, NY 12414

Former addresses
Carriage, Centereach, NY 11720
5 Carriage Ln, Centereach, NY 11720
41 Songsparrow Ln, Centereach, NY 11720
6 Lucille Dr, Hudson, NY 12534
360 Wood Hollow Rd, Great River, NY 11739
19 Harrison Ave, Centereach, NY 11720
1 Ross Ln, Mount Sinai, NY 11766
(631) 928-4897

Former phone numbers
(631) 585-1005
Harry H Weiner
Joyce C Weiner
Sandy D Weiner
Francine Berstell Weiner
Frank Weiner
Scott J Weiner
Ryan Michael Weiner
Robert Weiner
Barry H Weiner
Steven W Weiner
Born in 1967
2345 Union St,Allentown, PA 18104

Former addresses
56 Marcellus Dr, Newton, MA 02459
2522 Carriage Ln #3B, Fredericksburg, VA 22401
2345 Union Blvd, Allentown, PA 18109
505 Mall Blvd #106, Savannah, GA 31406
27 President Ave, Providence, RI 02906
2902 Birch Hollow Dr #1A, Ann Arbor, MI 48108
137 Taber Ave, Providence, RI 02906
(610) 416-6463

Former phone numbers
(912) 692-1114
(401) 272-4607
(610) 776-0378


Possible e-mails
swe859@aol.com, xman65@hotmail.com
Steven Jon Weiner
Born in 1970
35 Green Tree Dr,Belgrade, MT 59714

Former addresses
11928 Valley View Ave, Whittier, CA 90604
538 Hurdle Cir #441, Billings, MT 59102
2011 24th St, Billings, MT 59102
520 River Rock Dr, Belgrade, MT 59714
12002 Valley View Ave #2, Whittier, CA 90604
117 Main St, Livingston, MT 59047
150 Old Place Ln, Belgrade, MT 59714
4410 Old Court Rd #J, Pikesville, MD 21208
538 Hurdle Cir #445, Billings, MT 59102
30 Chestnut Dr, Billings, MT 59102
6630 Sheffield Ln #203CC, Miami Beach, FL 33141
12002 Valley View Ave, Whittier, CA 90604
800 Ocean Dr #18, Miami Beach, FL 33139
566 PO Box, Belgrade, MT 59714
800 Ocean Dr #18, Miami, FL 33139
800 Ocean Dr, Miami, FL 33139
800 Ocean Dr, Miami Beach, FL 33139
12002 Valley View Ave #1-CALV, Whittier, CA 90604
(406) 388-9413

Former phone numbers
(406) 656-5214
(406) 388-2287
(406) 388-9413
(305) 864-7600
(410) 486-3391
(562) 946-0910
(562) 946-0910


Possible e-mails
hotdogfamily@wmconnect.com, stevessecondsource@yahoo.com
Arnold Michael Weiner
Ralia L Weiner
Ralien L Weiner
Lori D Weiner
Railen L Weiner
Rachel Weiner
Ralien L Weiner
Steven G Weiner
Born in 1966
4115 182nd St #20,Torrance, CA 90504

Former addresses
4115 182nd St #20, Torrance, CA 90504
36 Cedarcrest Rd #501, Canton, MA 02021
1215 Empire St #15, Anaheim, CA 92804
11 Lewis Ave, Norwood, MA 02062
1415 North St #723, Anaheim, CA 92801
1440 Beacon St #409, Brookline, MA 02446
2414 Tustin Ave, Santa Ana, CA 92705
4115 182nd St #22, Torrance, CA 90504
(310) 214-4835

Former phone numbers
(617) 738-0460
(617) 828-5786
(310) 214-4835


Possible e-mails
sgwel@aol.com
Elenagirlie C Weiner
Steven Weiner
4 Hull Ct,Barnegat, NJ 08005
Jeanne N Wiener
Jean Weiner
Steven Jon Weiner
9040 Royal Palm Blvd #509,Coral Springs, FL 33065

Former addresses
9040 Royal Palm Blvd #A, Coral Springs, FL 33065
Steven J Weiner
Born in 1970
4849 Connecticut Ave #110,Washington, DC 20008

Former addresses
10 Cottage Ave #1, Arlington, MA 02474
8 Mayfair, Norwood, MA 02062
4849 Connecticut Ave #801, Washington, DC 20008
4849 Connecticut Ave #209, Washington, DC 20008
4849 Connecticut Ave #83, Washington, DC 20008
4849 Connecticut Ave, Washington, DC 20008
634 6th St #9, Lafayette, IN 47901
22 Bryon Rd #1, Chestnut Hill, MA 02467
4849 Connecticut Ave #310, Washington, DC 20008
15 Francis St #37, Brookline, MA 02446
(202) 421-7262

Former phone numbers
(617) 648-5653
(617) 731-4250
(202) 537-6637
Steven Gerald Weiner
Born in 1952
4120 Coconut Blvd,Royal Palm Beach, FL 33411

Former addresses
4120 Coconut Blvd, West Palm Bch, FL 33411
214 Sparrow Dr #4, Royal Palm Beach, FL 33411
10783 Camino Cir, Wellington, FL 33414
10783 Ci Cmno, Wellington, FL 33414
1914 12th Ave, Boynton Beach, FL 33426
1064 Sonata Way, Royal Palm Beach, FL 33411
4120 Coconut Blvd, West Palm Beach, FL 33411
(561) 683-1121

Former phone numbers
(561) 793-1585
(561) 737-2964


Possible e-mails
firemellow@hotmail.com, sgw12345@aol.com, steven@contractor.net, swskates@aol.com
Dorothy L Weiner
Dorothy Weiner
Terri Hope Weiner
Lauren Ashley Weiner
Edward M Weiner
Brooke A Weiner
Steven A Weiner
Born in 1949
14 Amy Ln,Plymouth, MA 02360

Former addresses
12 Cranberry Ln, Pembroke, MA 02359
(508) 746-0420

Former phone numbers
(508) 746-0420
(508) 740-9048


Possible e-mails
elemental_soul_2000@yahoo.com
Tonijo Fandelweiner
Harriet Alan Weiner
Michael S Weiner
Bryan Joseph Weiner
Steven P Weiner
Born in 1953
560 Pearl St,Brockton, MA 02301

Former addresses
560 P, Brockton, MA 02401
29 Maple Ave #2, Cambridge, MA 02139
(508) 588-8085

Possible e-mails
wein560@aol.com
Steven S Weiner
Born in 1966
33 Clarendon Ave,Brockton, MA 02301

Former addresses
504 Dongarry, North Easton, MA 02356
858 Washington St #B, Dedham, MA 02026
33 Clarence St, Brockton, MA 02301
33 Claredon St, Brockton, MA 02302
504 Dongary Rd, South Easton, MA 02375
(508) 583-6907

Possible e-mails
trxr4kdz1@aol.com
Vanta P Weiner
Harry Weiner
Steven Paul Weiner
Born in 1957
7065 130th St,Cleveland, OH 44130

Former addresses
11664 11th St, Davie, FL 33325
11664 11th St, Ft Lauderdale, FL 33325
1139 Westfield St #50, West Springfield, MA 01089
1588 Woodhurst Ave, Cleveland, OH 44124
7065 130th St #120E, Cleveland, OH 44130
9666 Independence Blvd, Cleveland, OH 44130
24181 Puritan Rd, Cleveland, OH 44123
11664 11th St, Fort Lauderdale, FL 33325
(954) 518-0273

Former phone numbers
(954) 370-6143
(954) 518-0273
(954) 370-0045
(216) 289-8296
(954) 370-0045
(954) 236-4585
(440) 843-8428
(954) 236-4585


Possible e-mails
nsyncluvr129@aol.com, wildturk54@aol.com
Lynne Mary Weiner
Diana S Weiner
Erin Weiner
Jaclyn A Weiner
Erin R Weiner
Steven Lynneweiner
Lawrence E Weiner
Marc D Weiner
Sara L Weiner

Associated names
Sara Weiner
Steven Neil Weiner
Born in 1971
3763 Hinds St,Seattle, WA 98126

Former addresses
1711 Massachusetts Ave #211, Washington, DC 20036
3 Pine St #7, Plaistow, NH 03865
1633 Blackstone Dr, Carrollton, TX 75007
2801 Western Ave #437, Seattle, WA 98121
852 Bird Ave #1, Birmingham, MI 48009
2250 Clarendon Blvd, Arlington, VA 22201
940 25th St #3125, Washington, DC 20037
4 Noyes Ln, Atkinson, NH 03811
1892 Kirts Blvd #218, Troy, MI 48084
41 Parish Dr, Andover, MA 01810
(248) 540-5949

Former phone numbers
(972) 446-4700
(810) 649-5312
(248) 540-5949
(603) 362-8888
(206) 906-9959
Linda P Weiner
Jane D Weiner
Edward F Weiner
Lauran Plaskoff Weiner
Lauran Weiner
Shipeng Wei
Robin Beth Weiner
Andrew Wein
Fedward Weiner
Steven Weiner
193 Southern Blvd,Smithtown, NY 11788
Heidi S Weiner
Steven H Weiner
Born in 1942
670 Tennis Club Dr #202,Fort Lauderdale, FL 33311

Former addresses
610 Nandina Dr, Fort Lauderdale, FL 33327
670 Tennis Club Dr, Fort Lauderdale, FL 33311
610 Tennis Club Dr #108, Fort Lauderdale, FL 33311
61 Beacon St #D, Burlington, MA 01803
670 Tennis Club Dr #202, Ft Lauderdale, FL 33311
61 Beacon St, Burlington, MA 01803
670 Tennis Club Dr, Ft Lauderdale, FL 33311
670 Tennis Club Dr #302, Ft Lauderdale, FL 33311
670 19th St, Fort Lauderdale, FL 33316
30 Cynthia Dr, Brockton, MA 02302
26 Beacon St #C, Burlington, MA 01803
61 Beacon St #C, Burlington, MA 01803
670 Tennis Club Dr #302, Fort Lauderdale, FL 33311
26 Beacon St #61C, Burlington, MA 01803
(954) 760-4083

Former phone numbers
(954) 760-4083
(508) 588-7173
(954) 524-6828
(954) 524-6828
(617) 229-8864


Possible e-mails
weiner.steve@gmail.com, weiner.steve@worldnet.att.net
Steve Weiner
Julie Robyn Weiner
Susan L Shumanweiner
Sue Weiner
Vivian D Brannon

Associated names
Susan Weiner
Steven T Weiner
Born in 1972
52 Summit St,Fairport, NY 14450

Former addresses
9 Waterworks Ln, Fairport, NY 14450
(585) 223-4981

Former phone numbers
(585) 415-7449
(716) 425-9186


Possible e-mails
sweinersts@aol.com
Steven Lehrhoff Weiner
Born in 1965
3627 Cody Rd,Sherman Oaks, CA 91403

Former addresses
3333 Bayaud Ave #803, Denver, CO 80209
13603 Marina Pointe Dr, Marina Del Rey, CA 90292
16 Halcourt Gdns, Amherst, MA 01002
3333 Bayaud Ave #802, Denver, CO 80209
535 Yale Ave, Claremont, CA 91711
1139 Yale St #3, Santa Monica, CA 90403
3333 Bayaud Ave, Denver, CO 80209
3627 Cody Rd, Van Nuys, CA 91403
9122 Cresta Dr, Los Angeles, CA 90035
(818) 981-5743

Former phone numbers
(303) 329-6885
(310) 829-7745
(818) 788-4544
(818) 981-5743


Possible e-mails
slehrhoff@aol.com
Debra S Lehrhofffaulkenberg
Barbara D Lehrhoff
Irwin P Lehrhoff
Demichele Kim Fw
Sherry L Lehrhoff
Wendy Susan Romoff
David L Weiner
Howard Allan Lehrhoff
Fu Mei Wei

Associated names
Steven Scott Lehrhoff

Steven Weiner Addresses, Phone Numbers

Name
Address
County
Phone
Steven Weiner
1650 BRYANT ST, PALO ALTO, CA, 94301
SANTA CLARA
(650) 322-4710
Steven Weiner
11401 NW 25TH ST, FORT LAUDERDALE, FL, 33323
BROWARD
(954) 472-0218
Steven Weiner
2121 N CALIFORNIA BLVD, WALNUT CREEK, CA, 94596
CONTRA COSTA
(925) 280-9350
Steven Weiner
4050 VIA DOLCE APT 343, MARINA DL REY, CA, 90292
LOS ANGELES
Steven Weiner
191 CASMIR DR, FAIRFIELD, CT, 6825
FAIRFIELD
(203) 371-8191
Steven Weiner
5935 CALMFIELD AVE, AGOURA HILLS, CA, 91301
LOS ANGELES
(818) 991-3455
Steven Weiner
101 MYSTIC PL, ALAMO, CA, 94507
CONTRA COSTA
Steven Weiner
6005 DALTON WAY, SAN RAMON, CA, 94582
CONTRA COSTA
Steven Weiner
1520 MONTEREY BLVD APT C, HERMOSA BEACH, CA, 90254
LOS ANGELES
Steven Weiner
821 S STEELE ST, DENVER, CO, 80209
DENVER
(303) 694-9473
Steven Weiner
4612 VARNA AVE, SHERMAN OAKS, CA, 91423
LOS ANGELES
(818) 995-0543
Steven Weiner
4115 W 182ND ST, TORRANCE, CA, 90504
LOS ANGELES
(310) 214-4835
Steven Weiner
4849 CONNECTICUT AVE NW, WASHINGTON, DC, 20008
DISTRICT OF COLUMBIA
(202) 537-6637
Steven Weiner
33001 ALPINE LN, EVERGREEN, CO, 80439
JEFFERSON
Steven Weiner
26716 SHOREWOOD RD, RANCHO PALOS VERDES, CA, 90275
LOS ANGELES
(310) 791-7251
Steven Weiner
4120 COCONUT BLVD, WEST PALM BEACH, FL, 33411
PALM BEACH
(561) 793-1585
Steven Weiner
11445 E CIMMARON DR, ENGLEWOOD, CO, 80111
ARAPAHOE
(303) 770-0934
Steven Weiner
5022 BOGEY PL, COCOA, FL, 32927
BREVARD
(321) 633-7033
Steven Weiner
236 PALO ALTO DR, GOLETA, CA, 93117
SANTA BARBARA
(805) 685-4143
Steven Weiner
26716 SHOREWOOD RD, RANCHO PALOS VERDES, CA, 90275
LOS ANGELES
(310) 791-7251
Steven Weiner
4612 VARNA AVE, SHERMAN OAKS, CA, 91423
LOS ANGELES
(818) 995-0543
Steven Weiner
4931 BARBADOS CT, OAK PARK, CA, 91377
VENTURA
Steven Weiner
5479 PTARMIGAN CIR, BOULDER, CO, 80301
BOULDER
(303) 530-9180
Steven Weiner
16623 E NAPA PL, AURORA, CO, 80013
ARAPAHOE
(303) 693-9373
Steven Weiner
2750 BROADWAY ST, BOULDER, CO, 80304
BOULDER
(303) 440-3093

Steven Weiner's Real Estate

Name
Owner Address
Real Estate Address
Value
Year of construction
WEINER, STEVEN G. & LISA BETH
21 BURLINGTON DRIVE, MARLBORO, NJ, 07746
Real Estate Address
21 BURLINGTON DRIVE, MARLBORO, NJ, 07746
Value $588,700
Year of construction 1994
WEINER STEVEN R
Real Estate Address
3755 PAIGE ST, PORT ORANGE, FL 32129
Year of construction 1976
WEINER, STEVEN D ET UX
837 GRAND CENTRAL DRIVE, HAMILTON NJ, 08619
Real Estate Address
4500 W BRIGANTINE AVE, NJ
Value $210,000
Year of construction 1987
WEINER STEVEN G L/E
10721 MIRASOL DR UNIT 601, MIROMAR LAKES, FL 33913
Real Estate Address
10721 MIRASOL DR, MIROMAR LAKES, FL 33913
Value $429,700
Year of construction 2007
WEINER, STEVEN & EDNA
19-21 SWAYZE STREET, WEST ORANGE, N.J., 07052
Real Estate Address
19-21 SWAYZE STREET, WEST ORANGE, N.J., 07052
Value $465,500
WEINER STEVEN A &
1110 SWEET HILL DR, JUPITER, FL 33458
Real Estate Address
1110 SWEET HILL DR, JUPITER, FL 33458
Value $297,480
WEINER STEVEN &
613 NE ROSSETTI LN, BOCA RATON, FL 33487
Real Estate Address
613 NE ROSSETTI LN, BOCA RATON, FL 33487
Value $421,840
Year of construction 2005
WEINER STEVEN
7162 VIA LEONARDO, LAKE WORTH, FL 33467
Real Estate Address
8162 PELICAN HARBOUR DR, LAKE WORTH, FL 33467
Year of construction 2000
WEINER STEVEN J &
29 WINDSOR DR, BOYNTON BEACH, FL 33436
Real Estate Address
29 WINDSOR DR, BOYNTON BEACH, FL 33436
Value $219,338
Year of construction 1990
WEINER STEVEN R &
7162 VIA LEONARDO, LAKE WORTH, FL 33467
Real Estate Address
7162 VIA LEONARDO, LAKE WORTH, FL 33467
Year of construction 2004
WEINER, STEVEN M & DARLENE H
5 GLENBROOK DR, MENDHAM, NJ, 07945
Real Estate Address
5 GLENBROOK DR, MENDHAM, NJ, 07945
Value $949,800
Year of construction 1971
WEINER, STEVEN B & LAURIE ANNE
111 SNOWHILL ST, SPOTSWOOD, NJ, 08884
Real Estate Address
111 SNOWHILL ST, SPOTSWOOD, NJ, 08884
Value $189,300
Year of construction 1956
WEINER STEVEN A &
3840 TIMBERS EDGE DR, GLENVIEW, IL 60025
Real Estate Address
16426 BRAEBURN RIDGE TRL, DELRAY BEACH, FL 33446
Year of construction 2004
WEINER STEVEN R
4669 PURDUE DR, BOYNTON BEACH, FL 33436
Real Estate Address
4669 PURDUE DR, BOYNTON BEACH, FL 33436
Value $115,000
Year of construction 1996
WEINER STEVEN & MAXINE
354 STREAMVIEW WAY, WINTER SPRINGS, FL 32708
Real Estate Address
354 STREAMVIEW WAY, WINTER SPRINGS, FL 32708
Value $137,091
Year of construction 1998
WEINER, STEVEN A
63 DAVENPORT RD, MONTVILLE, NJ, 07045
Real Estate Address
63 DAVENPORT RD, MONTVILLE, NJ, 07045
Value $316,800
Year of construction 1995
WEINER STEVEN A
4933 PIMLICO DR, TALLAHASSEE, FL 32309
Real Estate Address
4933 PIMLICO DR, TALLAHASSEE, FL 32309
Value $138,071
Year of construction 1986
WEINER MICHAEL STEVEN
NATHAN-WEINER CHERYL, ORLANDO, FLORIDA 32837
Real Estate Address
5147 BRIGHTMOUR CIR, ORLANDO, FL 32837
Value $226,751
Year of construction 1997
WEINER, STEVEN R
5022 BOGEY PL, COCOA, FL 32927
Real Estate Address
5022 BOGEY PL, COCOA, FL 32927
Value $157,260
Year of construction 2003
WEINER, STEVEN H & SAMSON, ROSANNA
694 DONALD DRIVE S, BRIDGEWATER NJ, 08807
Real Estate Address
694 DONALD DR SO, NJ
Value $317,600
Year of construction 1965

Steven Weiner in Car Registration Database

Name
Address
Phone
Car Model
VIN
Steven Weiner
4126 W FORK RIDGE DR, BATAVIA, OH 45103-3264
Car Model 2008 HONDA CIVIC
VIN 2HGFG21518H708178
Steven Weiner
8501 Falls Run Rd Apt E, Ellicott City, MD 21043-7380
(410) 465-3116
Car Model 2007 MINI COOPER
VIN WMWMF73557TL86226
Steven Weiner
1211 S Eads St Apt 402, Arlington, VA 22202-2886
Car Model 2010 VOLKSWAGEN JETTA
VIN 3VWTL7AJ6AM690031
Steven Weiner
PO Box 611479, Rosemary Beach, FL 32461-1008
Car Model 2009 PORSCHE 911
VIN WP0AB29959S721945
Steven Weiner
15820 Glacier Ct, North Potomac, MD 20878-3467
(301) 208-0641
Car Model 2007 CHRYSLER SEBRING
VIN 1C3LC66K17N530687
Steven Weiner
1000 3rd Ave SW, Le Mars, IA 51031-2543
Car Model 2009 TOYOTA AVALON
VIN 4T1BK36B29U343746
Steven Weiner
4612 Varna Ave, Sherman Oaks, CA 91423-3105
(818) 995-6001
Car Model 2007 ACURA TL
VIN 19UUA66297A013099
Steven Weiner
53 Joseph Byrne Dr, Brick, NJ 08724-7755
Car Model 2009 CHEVROLET HHR
VIN 3GNCA23B19S519378
Steven Weiner
5 Glenbrook Dr, Mendham, NJ 07945-2306
(973) 543-0553
Car Model 2008 ACURA RDX
VIN 5J8TB18278A003696
Steven Weiner
11 Palmer St, Hampton, NH 03842-1347
(603) 926-1496
Car Model 2007 TOYOTA CAMRY SOLARA
VIN 4T1FA38P37U122277
Steven Weiner
4931 Barbados Ct, Oak Park, CA 91377-5533
(818) 865-0201
Car Model 2008 LEXUS LS 460
VIN JTHBL46F585077317
Steven Weiner
12753 Daisywood Dr, Knoxville, TN 37932-1833
Car Model 2009 NISSAN SENTRA
VIN 3N1AB61E19L694518
Steven Weiner
2614 HAZELWOOD DR, RALEIGH, NC 27608-1414
(919) 782-8427
Car Model 2007 MAZDA MAZDA6
VIN 1YVHP84C775M20587
Steven Weiner
4120 Coconut Blvd, West Palm Beach, FL 33411-8934
Car Model 2007 MAZDA MAZDA3
VIN JM1BK323X71633279
Steven Weiner
PO BOX 1374, MARFA, TX 79843-1374
Car Model 2009 JEEP WRANGLER
VIN 1J4GA64129L770143
Steven Weiner
348 Frankel Blvd, Merrick, NY 11566-4734
Car Model 2008 HYUNDAI SANTA FE
VIN 5NMSH73E18H175693
Steven Weiner
3533 Windbluff Dr, Charlotte, NC 28277-9875
(704) 542-1942
Car Model 2009 HYUNDAI SANTA FE
VIN 5NMSH13E19H277428
Steven Weiner
19 Swayze St, West Orange, NJ 07052-2025
(973) 325-0093
Car Model 2009 JEEP LIBERTY
VIN 1J8GN28K69W545849
Steven Weiner
25935 148th Dr, Rosedale, NY 11422-3001
(718) 527-2345
Car Model 2009 HYUNDAI ELANTRA
VIN KMHDU46D69U805820
Steven Weiner
PO Box 2542, Lilburn, GA 30048-2542
(678) 522-5800
Car Model 2007 HONDA CR-V
VIN JHLRE38737C069031
Steven Weiner
16623 E NAPA PL, AURORA, CO 80013-2919
(303) 693-9373
Car Model 2009 MERCURY MARINER
VIN 4M2CU97739KJ05779
Steven Weiner
2614 Hazelwood Dr, Raleigh, NC 27608-1414
Car Model 2009 TOYOTA COROLLA
VIN 2T1BU40E99C044534
Steven Weiner
5022 BOGEY PL, COCOA, FL 32927
(386) 290-5248
Car Model 2007 FORD EXPLORER
VIN 1FMEU63E87UA50177
Steven Weiner
4612 Varna Ave, Sherman Oaks, CA 91423-3105
(818) 995-6001
Car Model 2008 CADILLAC SRX
VIN 1GYEE637380129276
Steven Weiner
16426 BRAEBURN RIDGE TRL, DELRAY BEACH, FL 33446-9508
Car Model 2010 FORD EXPEDITION EL
VIN 1FMJK1K51AEA29472

Steven Weiner in Company Registration Database

Name
Company Name
Company Address
Position
Creation Date
Company Status
STEVEN K. WEINER
230 P'TREE ST.,N.W., STE 900 , ATLANTA, GA 30303
Position registered agent
STEVEN L. WEINER
Company INKNOWVATIONS, INC.
2333 SAN RAMON VALLEY BLVD., #250 , SAN RAMON, CA 94583
Position registered agent
Creation Date 1988-06-21
Company Status Suspended
STEVEN F. WEINER
100 MIMOSA DR. , THOMASVILLE, GA 31792
Position registered agent
STEVEN WEINER
Position REAL PROPERTY
STEVEN WEINER
959 MAIN STREET, SPRINGFIELD MA 01103
Position SECRETARY
STEVEN WEINER
959 MAIN ST.,, SPRINGFIELD MA
Position SECRETARY
Steven K. Weiner
235 Peachtree Street Suite 400 , Atlanta, GA 30303
Position registered agent
STEVEN L WEINER
Company HORIZON SUNGLASSES LTD.
8939 S. SEPULVEDA BLVD STE. 110-776, LOS ANGELES, CA 90045
Position registered agent
Creation Date 2008-11-10
Company Status Dissolved
STEVEN K. WEINER
235 PEACHTREE ST NW STE 400 , ATLANTA, GA 30303
Position registered agent
STEVEN F. WEINER
100 MIMOSA DR, 3RD FLOOR , THOMASVILLE, GA 31792
Position registered agent
STEVEN WEINER
3 HASKELL STREET, NORTON MA 02766
Position TREASURER
STEVEN K. WEINER
235 PEACHTREE ST NW STE 400 , ATLANTA, GA 30303
Position registered agent
STEVEN L WEINER
Company V.R.C. INDUSTRIES, INC.
294 HAYES , IRVINE, CA 92620
Position registered agent
Creation Date 2003-04-07
Company Status Surrendered
STEVEN WEINER
147 LYNWOOD DR.,, LONGMEADOW MA
Position SECRETARY
STEVEN WEINER
3 HASKELL STREET, NORTON MA 02766
Position PRESIDENT
STEVEN L WEINER
Company STEVEN L. WEINER LTD.
8939 S SEPULVEDA BLVD STE 110-776 , LOS ANGELES, CA 90045
Position registered agent
Creation Date 2006-02-22
Company Status Dissolved
STEVEN K WEINER
230 PEACHTREE ST STE 900 , ATLANTA, GA 30303
Position registered agent
STEVEN WEINER
Company JMK SERVICES, INC.
235 PEACHTREE ST STE 400 , ATLANTA, GA 30303
Position registered agent
Creation Date 1991-01-10
Company Status Active/Compliance
STEVEN L WEINER
Company ASCENT TALENT, MODEL, PROMOTION LTD.
8939 S SEPULVEDA BLD STE 110-776 , LOS ANGELES, CA 90045
Position registered agent
Creation Date 2006-02-22
Company Status Active
STEVEN J WEINER
2020 ELMWOOD AVE , BUFFALO NY 14207
Position PRESIDENT
STEVEN K. WEINER
230 PEACHTREE ST, NW, STE 900 , ATLANTA, GA 30303
Position registered agent
STEVEN ALAN WEINER
Company TOLVEN, INC.
18955 VIEWCREST DR , SONOMA, CA 95476
Position registered agent
Creation Date 2010-11-12
Company Status Active
STEVEN F. WEINER
Company STEVEN F. WEINER, M.D., PC
PO BOX 611469 , ROSEMARY BEACH, GA 32461
Position registered agent
Creation Date 2001-10-22
Company Status Diss./Cancel/Terminat
STEVEN WEINER
940 MAIN ST.,, SPRINGFIELD MA
Position SECRETARY
STEVEN K. WEINER
100 PEACHTREE STREET NW STE200 , ATLANTA, GA 30303
Position registered agent
STEVEN F WEINER
Company DOCTORSBAG.COM, INC.
100 MIMOSA DR , THOMASVILLE, GA 31792
Position registered agent
Creation Date 2000-01-03
Company Status Election to LLC/LP
STEVEN K. WEINER
235 PEACHTREE ST NW STE 400 , ATLANTA, GA 30303
Position registered agent
STEVEN L. WEINER
Company INNOVATIVE CREATIONS
3180 CROW CANYON PLACE #127 , SAN RAMON, CA 94583
Position registered agent
Creation Date 1998-11-10
Company Status Suspended
STEVEN WEINER
230 PEACHTREE STREET STE 900 , ATLANTA, GA 30303
Position registered agent
STEVEN WEINER
3 HASKELL STREET, NORTON MA 02766
Position DIRECTOR
STEVEN K WEINER
230 PEACHTREE ST STE 900 , ATLANTA, GA 30303
Position registered agent
STEVEN EARL WEINER
Company SKS ALLIANCE
1611 N SCHRADER 1611 N SCHRADER, LOS ANGELES, CA 90028
Position President
Creation Date 2003-07-16
Company Status Permanently Revoked
STEVEN K. WEINER
235 PEACHTREE ST.NE#400 , ATLANTA, GA 30303
Position registered agent
STEVEN F. WEINER
Company STEVEN F. WEINER, M.D., PC
PO BOX 611469 , ROSEMARY BEACH, GA 32461
Position registered agent
Creation Date 2001-10-22
Company Status Diss./Cancel/Terminat
STEVEN K. WEINER
235 PEACHTREE ST NW STE 400 , ATLANTA, GA 30303
Position registered agent
STEVEN K. WEINER
235 PEACHTREE ST, STE 400 , ATLANTA, GA 30303
Position registered agent
STEVEN F. WEINER
100 MIMOSA DRIVE , THOMASVILLE, GA 31792
Position registered agent
STEVEN K WEINER
230 PEACHTREE ST STE 900 , ATLANTA, GA 30303
Position registered agent
STEVEN F. WEINER
Company STEVEN F. WEINER, M.D., PC
PO BOX 611469 , ROSEMARY BEACH, GA 32461
Position registered agent
Creation Date 2001-10-22
Company Status Diss./Cancel/Terminat
STEVEN K. WEINER
235 PEACHTREE ST NW STE 400 , ATLANTA, GA 30303
Position registered agent
THEANI C LOUSKOS
Company STEVEN S. WEINER AND ASSOCIATES, INC.
900 FRONT ST #300 , SAN FRANCISCO, CA 94111
Position registered agent
Creation Date 1996-08-21
Company Status Dissolved
STEVEN K. WEINER
235 PEACHTREE ST, STE 400 , ATLANTA, GA 30303
Position registered agent
STEVEN K. WEINER
235 PEACHTREE ST NW STE 400 , ATLANTA, GA 30303
Position registered agent
STEVEN K. WEINER
235 PEACHTREE ST, STE 400 , ATLANTA, GA 30303
Position registered agent
STEVEN L WEINER
Company STEVEN L. WEINER, A PROFESSIONAL CORPORATION
2333 SAN RAMON VALLEY BLVD, STE. 250 , SAN RAMON, CA 94583
Position registered agent
Creation Date 1986-08-01
Company Status Suspended

Steven Weiner Marketing Data

Name, Address, Phone
Marketing Data
Mr. Steven Weiner
309 San Leon Irvine CA 92606 -8253
(949) 856-1780
Income - estimated household: $25,000 - $29,999
Estimated net worth: $5,000 - $9,999
Ethnic group: Jewish
Mr. Steven F Weiner
3414 Associated Way Owings Mills MD 21117 APT 421-6040
(443) 929-1482
Range of new credit: $501 - $1,000
Education: Completed College
Ethnic group: Jewish
Mr. Steven Weiner
1507 San Pascual St Santa Barbara CA 93101 -4105
(805) 963-0505
Income - estimated household: $35,000 - $39,999
Range of new credit: $5,001 - $9,999
Education: Completed Graduate School
Ethnic group: Jewish
Mr. Steven J Weiner
4849 Connecticut Ave NW Washington DC 20008-5853 APT 310-5804
(202) 537-6637
Income - estimated household: $75,000 - $99,999
Estimated net worth: $100,000 - $249,999
Range of new credit: $1,001 - $3,000
Education: Completed Graduate School
Ethnic group: Jewish
Mr. Steven A Weiner
2200 Vinewood Blvd Ann Arbor MI 48104-2764 -2764
(734) 417-1823
Income - estimated household: $250,000 +
Estimated net worth: Greater than $499,999
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Jewish
Mr. Steven A Weiner
8863 Via Prestigio W West Palm Beach FL 33411 -6513
(561) 784-1852
marilynweiner@msn.com
Income - estimated household: $100,000 - $149,999
Estimated net worth: $1 - $4,999
Range of new credit: $501 - $1,000
Education: Completed High School
Ethnic group: Jewish
Mr. Steven R Weiner
2174 Washington Dr Northbrook IL 60062 -7801
(224) 213-7191
Home owner source: Verified Home Owner
Income - estimated household: $100,000 - $149,999
Estimated net worth: Greater than $499,999
Lines of credit (trade counter): 4 Lines
Education: Completed College
Ethnic group: Jewish
Mr. Steven Weiner
30 Cynthia Dr Brockton MA 02302 -2157
(508) 588-7173
Home owner source: Verified Home Owner
Income - estimated household: $65,000 - $74,999
Estimated net worth: $50,000 - $99,999
Range of new credit: $501 - $1,000
Education: Completed College
Ethnic group: Jewish
Mr. Steven Weiner
21038 Blythe St Canoga Park CA 91304 -5111
(818) 341-1158
Home owner source: Verified Home Owner
Income - estimated household: $25,000 - $29,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $3,001 - $5,000
Education: Completed College
Ethnic group: Jewish
Mr. Steven M Weiner
1260 Shelley St Manhattan Beach CA 90266 -6943
(310) 313-2809
maweiner@gmail.com
Income - estimated household: $250,000 +
Estimated net worth: $10,000 - $24,999
Lines of credit (trade counter): 2 Lines
Range of new credit: $101 - $300
Education: Completed College
Ethnic group: Jewish
Mr. Steven D Weiner
4931 Barbados Ct Oak Park CA 91377 -5533
(818) 865-0201
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 2 Lines
Education: Completed High School
Ethnic group: Jewish
Mr. Steven B Weiner
7669 Springwater Pl Boynton Beach FL 33437-5492 APT 202-5492
(561) 731-1848
Home owner source: Verified Home Owner
Income - estimated household: $60,000 - $64,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $3,001 - $5,000
Education: Completed Graduate School
Ethnic group: Jewish
Mr. Steven W Weiner
11401 Nw 25th St Fort Lauderdale FL 33323 -1847
(954) 472-0218
moe123@comcast.net
Income - estimated household: $100,000 - $149,999
Estimated net worth: $250,000 - $499,999
Range of new credit: $501 - $1,000
Education: Completed High School
Ethnic group: Jewish
Mr. Steven A Weiner
105 Broadlands Dr Eatonton GA 31024 -5680
(706) 485-5087
Home owner source: Verified Home Owner
Income - estimated household: $150,000 - $174,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 4 Lines
Range of new credit: Greater than $9,999
Education: Completed Graduate School
Ethnic group: Jewish
Mr. Steven N Weiner
1322 Rose Ct W Buffalo Grove IL 60089 -3255
(847) 749-1799
Home owner source: Verified Home Owner
Income - estimated household: $175,000 - $199,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 6 Lines
Range of new credit: $501 - $1,000
Education: Completed High School
Ethnic group: Jewish
Mr. Steven C Weiner
15820 Glacier Ct Gaithersburg MD 20878 -3467
(301) 208-0641
Home owner source: Verified Home Owner
Income - estimated household: $250,000 +
Estimated net worth: Greater than $499,999
Lines of credit (trade counter): 2 Lines
Education: Completed Graduate School
Ethnic group: Jewish
Mr. Steven L Weiner
101 Mystic Pl Alamo CA 94507 -1417
(520) 906-0494
Home owner source: Verified Home Owner
Income - estimated household: $250,000 +
Estimated net worth: Greater than $499,999
Lines of credit (trade counter): 5 Lines
Range of new credit: $501 - $1,000
Education: Completed High School
Ethnic group: Jewish
Mr. Steven J Weiner
4050 Via Dolce Marina Del Rey CA 90292 APT 343-5256
(310) 823-5744
stevenweiner1@comcast.net
Home owner source: Verified Home Owner
Estimated net worth: Greater than $499,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $101 - $300
Education: Completed College
Ethnic group: Jewish
Mr. Steven D Weiner
16623 E Napa Pl Aurora CO 80013 -2919
(303) 693-9373
Home owner source: Verified Home Owner
Income - estimated household: $100,000 - $149,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $1,001 - $3,000
Education: Completed Graduate School
Ethnic group: Jewish
Mr. Steven P Weiner
191 Casmir Dr Fairfield CT 06825 -1227
(203) 371-8191
Home owner source: Verified Home Owner
Income - estimated household: $200,000 - $249,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 2 Lines
Range of new credit: $501 - $1,000
Education: Completed College
Ethnic group: Jewish
Mr. Steven Weiner
354 Streamview Way Winter Springs FL 32708 -6407
(407) 977-1635
Home owner source: Verified Home Owner
Income - estimated household: $200,000 - $249,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $501 - $1,000
Education: Completed College
Ethnic group: Jewish
Mr. Steven Weiner
9 Newtown Ct E Buffalo Grove IL 60089 -1526
(847) 459-1526
maureenweiner@hotmail.com
Home owner source: Verified Home Owner
Income - estimated household: $25,000 - $29,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 9+ Lines
Range of new credit: $501 - $1,000
Education: Completed High School
Ethnic group: Jewish
Mr. Steven Weiner
33 Clarendon Ave Brockton MA 02301 -4811
(508) 583-6907
bbwis66@aol.com
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Jewish
Mr. Steven J Weiner
3067 Madison Lake Ct Adrian MI 49221 -4100
(517) 263-0115
Home owner source: Verified Home Owner
Income - estimated household: $150,000 - $174,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $5,001 - $9,999
Education: Completed Graduate School
Ethnic group: Jewish
Mr. Steven I Weiner
5935 Calmfield Ave Agoura Hills CA 91301 -2101
(818) 991-3455
rgweiner1@gmail.com
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: Greater than $499,999
Lines of credit (trade counter): 2 Lines
Range of new credit: $101 - $300
Education: Completed Graduate School
Ethnic group: Jewish
Mr. Steven J Weiner
821 S Steele St Denver CO 80209 -4841
(303) 694-9473
mollyweiner@msn.com
Home owner source: Verified Home Owner
Income - estimated household: $250,000 +
Estimated net worth: Greater than $499,999
Lines of credit (trade counter): 2 Lines
Range of new credit: $3,001 - $5,000
Education: Completed Graduate School
Ethnic group: Jewish
Mr. Steven Weiner
3 Haskell St Norton MA 02766 -1831
(508) 285-4255
kaykayrw3@aol.com
Home owner source: Verified Home Owner
Income - estimated household: $65,000 - $74,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 4 Lines
Range of new credit: $5,001 - $9,999
Education: Completed High School
Ethnic group: Jewish
Mr. Steven A Weiner
14 Amy Ln Plymouth MA 02360 -5003
(508) 740-9048
hsbmweiner@hotmail.com
Home owner source: Verified Home Owner
Income - estimated household: $60,000 - $64,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 2 Lines
Range of new credit: $5,001 - $9,999
Education: Completed High School
Ethnic group: Jewish
Mr. Steven J Weiner
3530 Keswick Rd Baltimore MD 21211 -2637
(410) 889-3644
steven.j.weiner@verizon.net
Home owner source: Verified Home Owner
Income - estimated household: $10,000 - $14,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $101 - $300
Education: Completed Graduate School
Ethnic group: Jewish
Mr. Steven R Weiner
7603 Powhatan St Hyattsville MD 20784 APT 760-3525
(301) 577-1683
srw37@hotmail.com
Home owner source: Verified Home Owner
Income - estimated household: $65,000 - $74,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $5,001 - $9,999
Education: Completed High School
Ethnic group: Jewish

Steven Weiner Whois Records

Domain
Registrar Data
5thstreetburger.com
srw540i@gmail.com
Whois sever: whois.godaddy.com
Create / update date: 04-jan-2012 / 04-jan-2012
GODADDY.COM, LLC
640 N. La Salle St.|Suite 268 Chicago Illinois 60610, UNITED STATES
ascenttalent.com
SWEINER@ASCENTTALENT.COM
Whois sever: whois.enom.com
Create / update date: 10-oct-2002 / 11-sep-2013
ENOM, INC.
8939 S. SEPULVEDA BLVD|STE 110-776 LOS ANGELES CA 90045, UNITED STATES
boulevardshotsandburgers.com
steve@vvventures.net
Whois sever: whois.godaddy.com
Create / update date: 24-jul-2012 / 24-jul-2012
GODADDY.COM, LLC
640 N. La Salle St.|Suite 295 Chicago Illinois 60654, UNITED STATES
bronxconstructionaccidentlawyersfirm.com
sweiner@reibmanweiner.com
Whois sever: whois.godaddy.com
Create / update date: 26-feb-2010 / 09-oct-2012
GODADDY.COM, LLC
26 Court Street|Suite 1005 Brooklyn New York 11242, UNITED STATES
bronxlawyersfirm.com
sweiner@reibmanweiner.com
Whois sever: whois.godaddy.com
Create / update date: 26-feb-2010 / 09-oct-2012
GODADDY.COM, LLC
26 Court Street|Suite 1005 Brooklyn New York 11242, UNITED STATES
bronxmedicalmalpracticelawyersfirm.com
sweiner@reibmanweiner.com
Whois sever: whois.godaddy.com
Create / update date: 26-feb-2010 / 09-oct-2012
GODADDY.COM, LLC
26 Court Street|Suite 1005 Brooklyn New York 11242, UNITED STATES
brooklynconstructionaccidentlawyersfirm.com
sweiner@reibmanweiner.com
Whois sever: whois.godaddy.com
Create / update date: 26-feb-2010 / 09-oct-2012
GODADDY.COM, LLC
26 Court Street|Suite 1005 Brooklyn New York 11242, UNITED STATES
brooklynmedicalmalpracticelawyersfirm.com
sweiner@reibmanweiner.com
Whois sever: whois.godaddy.com
Create / update date: 26-feb-2010 / 09-oct-2012
GODADDY.COM, LLC
26 Court Street|Suite 1005 Brooklyn New York 11242, UNITED STATES
carboxygelmask.com
w2steve@gmail.com
Whois sever: whois.godaddy.com
Create / update date: 05-feb-2013 / 19-sep-2013
GODADDY.COM, LLC
128 W. First Ave.|Suite 200 Denver Colorado 80223, UNITED STATES
denvergiveandtake.com
w2steve@gmail.com
Whois sever: whois.godaddy.com
Create / update date: 15-sep-2012 / 19-sep-2013
GODADDY.COM, LLC
2250 S Oneida St.|Suite 302 Denver Colorado 80224, UNITED STATES
fifthstreetburger.com
srw540i@gmail.com
Whois sever: whois.godaddy.com
Create / update date: 04-jan-2012 / 04-jan-2012
GODADDY.COM, LLC
640 N. La Salle St.|Suite 268 Chicago Illinois 60610, UNITED STATES
gettshirty.com
steve@intrafusiontech.com
Whois sever: whois.godaddy.com
Create / update date: 14-jun-2011 / 15-jun-2013
GODADDY.COM, LLC
4669 Purdue Dr Boynton Beach Florida 33436, UNITED STATES
headinjurylawyersfirm.com
sweiner@reibmanweiner.com
Whois sever: whois.godaddy.com
Create / update date: 21-oct-2010 / 09-oct-2012
GODADDY.COM, LLC
26 Court Street|Suite 1005 Brooklyn New York 11242, UNITED STATES
medicalfusion.com
support@godaddy.com
Whois sever: whois.godaddy.com
Create / update date: 25-oct-2002 / 26-oct-2013
GODADDY.COM, LLC
c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260, UNITED STATES
myhoapayments.com
steve@intrafusiontech.com
Whois sever: whois.godaddy.com
Create / update date: 29-nov-2010 / 05-nov-2012
GODADDY.COM, LLC
4669 Purdue Dr Boynton Beach Florida 33436, UNITED STATES
newyorkcitypersonalinjurylawyersfirm.com
sweiner@reibmanweiner.com
Whois sever: whois.godaddy.com
Create / update date: 26-feb-2010 / 09-oct-2012
GODADDY.COM, LLC
26 Court Street|Suite 1005 Brooklyn New York 11242, UNITED STATES
pierrecardincoordinating.com
stevenjoel11@aol.com
Whois sever: whois.godaddy.com
Create / update date: 13-aug-2010 / 14-aug-2012
GODADDY.COM, LLC
100 winston drive|unit 7k north cliffside park New Jersey 07010, UNITED STATES
pizzaharness.com
steve@productinnovationsllc.com
Whois sever: whois.godaddy.com
Create / update date: 20-oct-2013 / 20-oct-2013
GODADDY.COM, LLC
101 mystic place alamo California 94507, UNITED STATES
queensscaffoldaccident.com
sweiner@reibmanweiner.com
Whois sever: whois.godaddy.com
Create / update date: 21-oct-2010 / 09-oct-2012
GODADDY.COM, LLC
26 Court Street|Suite 1005 Brooklyn New York 11242, UNITED STATES
queensscaffoldaccidentlawyer.com
sweiner@reibmanweiner.com
Whois sever: whois.godaddy.com
Create / update date: 21-oct-2010 / 09-oct-2012
GODADDY.COM, LLC
26 Court Street|Suite 1005 Brooklyn New York 11242, UNITED STATES
steveandmerry.com
StevenW@hghtest.com
Whois sever: whois.godaddy.com
Create / update date: 07-may-2005 / 08-may-2012
GODADDY.COM, LLC
900 East Indiantown Rd|Suite 308 Jupiter Florida 33477, UNITED STATES
thecolonyatpawleys.com
sweiner@redcopropertycompany.com
Whois sever: whois.godaddy.com
Create / update date: 07-jul-2010 / 07-jul-2010
GODADDY.COM, LLC
629 Parsippany Road Parsippany New Jersey 07054, UNITED STATES
personalinjuryoffices.com
attorneyweiner@weinerlawoffice.com
Whois sever: whois.names4ever.com
Create / update date: 03-jun-2004 / 03-jun-2013
HOSTOPIA.COM INC. D/B/A APLUS.NET
1850 Mt. Diablo Blvd, Suite 620 Walnut Creek CA 94596, UNITED STATES
19258387510
redcopropertycompany.com
aweiner@redcopropertycompany.com
Whois sever: whois.schlund.info
Create / update date: 03-feb-2010 / 04-feb-2013
1 & 1 INTERNET AG
629 Parsippany Rd Parsippany NJ 07054, UNITED STATES
19738847300
stevenfweiner.com
steve@stevenfweiner.com
Whois sever: whois.register.com
Create / update date: 22-jun-2002 / 17-oct-2013
REGISTER.COM, INC.
PO Box 611469 Rosemary Beach FL 32461, UNITED STATES
18506221214
stevenweiner.com
firemellow@yahoo.com
Whois sever: whois.tucows.com
Create / update date: 01-feb-2002 / 06-jul-2013
TUCOWS DOMAINS INC.
Camino Cir Wellington FL 33414, UNITED STATES
15612494866
steveweiner.com
firemellow@yahoo.com
Whois sever: whois.tucows.com
Create / update date: 01-feb-2002 / 06-jul-2013
TUCOWS DOMAINS INC.
Camino Cir Wellington FL 33414, UNITED STATES
15612494866
thbarker.com
steve@readmorecommunications.com
Whois sever: whois.register.com
Create / update date: 26-apr-2001 / 21-oct-2013
REGISTER.COM, INC.
6065 SW Glenbrook Road Beaverton OR 97007, UNITED STATES
15035260270
weinerlawoffice.com
attyweiner@aol.com
Whois sever: whois.tucows.com
Create / update date: 05-mar-2003 / 09-feb-2013
TUCOWS DOMAINS INC.
101 mystic place alamo CA 94507, UNITED STATES
19259984946
worthagency.com
sweiner@redcopropertycompany.com
Whois sever: whois.schlund.info
Create / update date: 16-aug-2010 / 17-aug-2013
1 & 1 INTERNET AG
63 Davenport Rd Montville NJ 07045, UNITED STATES
19736155493

Donations from Steven Weiner

Name
Address
Occupation
Amount
Recipient
Steven Weiner
980 MAIN ST SPRINGFIELD MA 01103
Occupation ATTORNEY, SELF-EMPLOYED
Amount $300.00
Recipient SWAN, BENJAMIN
Steven Weiner
1415 MADRID Rd SANTA FE NM 87505
Occupation ORTHOPEDIC SURGEON, SANTA FE ORTHOPEDIC ASSOCIATION
Amount $1000.00
Recipient Bill Richardson (D)
Steven Weiner
821 S Steele St DENVER CO 80209
Occupation financial consultant, Signet Partners
Amount $250.00
Recipient Edwin G Perlmutter (D)
Steven Weiner
Occupation
Amount $250.00
Recipient Barack Obama (D)
Steven Weiner
1415 MADRID PL SANTA FE NM 87505
Occupation ORTHOPAEDIC SURGEON
Amount $150.00
Recipient DENISH, DIANE D (LTG)
Steven Weiner
Occupation RETIRED, RETIRED
Amount $500.00
Recipient David Vitter (R)
Steven Weiner
Occupation C & R MANAGEMENT CORP
Amount $500.00
Recipient Burt Cohen (D)
Steven Weiner
821 S Steele St DENVER CO 80209
Occupation Financial Services, Signet Partners
Amount
Recipient
Steven Weiner
3067 MADISON ADRIAN MI 49221
Occupation
Amount $100.00
Recipient SCHMIDT, HARVEY E
Steven Weiner
3067 MADISON LK CT ADRIAN MI 49221
Occupation
Amount $100.00
Recipient SIMPSON, MIKE
Steven Weiner
147 LYNNWOOD DR LONGMEADOW MA 01106
Occupation ATTORNEY, SELF-EMPLOYED
Amount $250.00
Recipient PATRICK, DEVAL L (G)
Steven Weiner
3 VALLEYS CREST CT OWINGS MILLS MD 21117
Occupation
Amount $1000.00
Recipient EHRLICH JR, ROBERT L (G)
Steven Weiner
235 PEACHTREE ST ATLANTA GA 30303
Occupation ATTORNEY, THE WEINER LAW GROUP
Amount $500.00
Recipient SCHAEFFER, DAVID N
Steven Weiner
3 VALLEYS CREST CT OWINGS MILLS MD 21117
Occupation
Amount $100.00
Recipient ZIRKIN, BOBBY A
Steven Weiner
147 LYNNWOOD DR LONGMEADOW MA 01106
Occupation ATTORNEY, SELF-EMPLOYED
Amount $300.00
Recipient PATRICK, DEVAL L (G)
Steven Weiner
Occupation
Amount $-2300.00
Recipient Bill Richardson (D)
Steven Weiner
65 E 76TH ST NEW YORK NY 10021
Occupation
Amount $100.00
Recipient BARBER, DON
Steven Weiner
1630 HOSPITAL Dr SANTA FE NM 87505
Occupation ORTHOPEDIC SURGEON, SANTA FE ORTHOPEDIC ASSOCIATION
Amount $2300.00
Recipient Bill Richardson (D)
Steven Weiner
Occupation N/A/RETIRED
Amount
Recipient
Steven Weiner
147 LYNNWOOD DR LONGMEADOW MA 01106
Occupation ATTORNEY, SELF-EMPLOYED
Amount $200.00
Recipient PATRICK, DEVAL L (G)
Steven Weiner
1415 MADRID PLACE SANTA FE NM 87505
Occupation ORTHOPEDIC SURGEON, SANTA FE ORTHOPEDIC ASSOCIATION
Amount $1300.00
Recipient Bill Richardson (D)
Steven Weiner
821 S Steele St DENVER CO 80209
Occupation financial consultant, Signet Partners
Amount
Recipient
Steven Weiner
60 Pompton Ave VERONA NJ 07044
Occupation Attorney, O'Toole Fernandex Weiner Van Lieu
Amount $287.00
Recipient Scott Garrett (R)
Steven Weiner
147 LYNNWOOD DR LONGMEADOW MA 01106
Occupation
Amount $-50.00
Recipient PATRICK, DEVAL L (G)
Steven Weiner
235 PEACHTREE ST ATLANTA GA 30303
Occupation ATTORNEY, SELF EMPLOYED
Amount $6100.00
Recipient BARNES, ROY E


People Finder Catalog

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z 


0.054 s.