Filter
All 190 Facebook 40LinkedIn 19Contacts 25Addresses 25Real Estate 3Cars 18Business 13Marketing 30Whois 7US Voter 10

Frank Massey Facebook Profiles

Frank Massey facebook profile
Frank Massey, Frank-Massey
Lives in Cleburne, Texas
Studied Public administration at University of Texas Pan American
Captain (nautical) at Garland Fire Department
Frank Massey III (Pop Culture Lounge) facebook profile
Frank Massey III (Pop Culture Lounge), frankmasseyiii
Lives in Lorain, Ohio
Studied at United States Army '89
Pop Culture Lover and Critic at Pop Culture
Frank Massey facebook profile
Frank Massey, Frank-Massey
Lives in Ardmore, Oklahoma
Went to Osbourn Park High School
Osbourn Park High School
Frank Massey facebook profile
Frank Massey, frank.massey.777
Lives in Ardmore, Oklahoma
Studied Information Technology at Murray State College
Murray State College
Frank Massey facebook profile
Frank Massey, massey76
Lives in Ardmore, Oklahoma
Ardmore, Oklahoma
Frank Massey facebook profile
Frank Massey, frank.massey.376
Lives in Ocala, Florida
Ocala, Florida
Frank Massey facebook profile
Frank Massey, frank.massey.716
Lives in Parkersburg, West Virginia
Parkersburg, West Virginia
Frank Massey (Reggie) facebook profile
Frank Massey (Reggie), Frank-Massey
Lives in Houston, Texas
Went to Macarthur High School
Cook at Sonic Drive-In
Frank Massey facebook profile
Frank Massey, frank.massey
Lives in Oklahoma City, Oklahoma
Oklahoma City, Oklahoma
Frank Massey facebook profile
Frank Massey, frank.massey.754
Studied at The University of Arizona
The University of Arizona
Frank Massey facebook profile
Frank Massey
Studied at Bolton College
Bolton College
Frank Massey facebook profile
Frank Massey, Frank-Massey
Lives in Waukegan, Illinois
Studied PhD in Psychology never finished at University of Pennsylvania '05
Partner at Massey wheeler investor relations consultants
Frank Massey facebook profile
Frank Massey, frank.massey.142
Worked at Mercedes-Benz
Went to Lanier Senior High School
Lanier Senior High School
Frank Massey facebook profile
Frank Massey, frank.massey.1422
Went to groventon '76
Paint Instructor at Flatwoods Job Corps Center
Frank Massey facebook profile
Frank Massey
Lives in San Antonio, Texas
Went to Thomas Jefferson
Thomas Jefferson
Frank Massey facebook profile
Frank Massey, frank.massey.526
Lives in Indiana, Pennsylvania
Indiana, Pennsylvania
Frank Massey facebook profile
Frank Massey, frank.massey.520
Lives in Detroit, Michigan
Went to Robichaud Senior High School '74
Robichaud Senior High School
Frank Massey facebook profile
Frank Massey, frank.massey.902
Lives in Shacklefords, Virginia
Studied Economics and Finance at University of Richmond '70
University of Richmond
Frank Massey facebook profile
Frank Massey, Frank-Massey
Lives in Knoxville, Tennessee
Former Painter at Leon County School Board
Knoxville, Tennessee
Frank Massey (Elric shadowmoon) facebook profile
Frank Massey (Elric shadowmoon), frank.massey.5243
Lives in Gastonia, North Carolina
Former House painter and decorator at Leon County Schools
Gastonia, North Carolina
Frank Massey facebook profile
Frank Massey, frank.massey.1426
Lives in Toronto, Ontario
Toronto, Ontario
Frank Massey facebook profile
Frank Massey, Frank-Massey
Lives in Cartwright, Oklahoma
Went to Colbert Public Schools '02
Works at Cruz Landscaping
Frank Massey facebook profile
Frank Massey, frank.massey.104
Worked at * HeArT HaCkeR *
Goes to florence public school Mayur vihar Delhi
florence public school Mayur vihar Delhi
Frank Massey facebook profile
Frank Massey
From Annapolis, Maryland
Studied Math at University of Maryland
University of Maryland
Frankie Massey facebook profile
Frankie Massey
Lives in Austin, Texas
Went to Boerne-Samuel V. Champion High School '09
Sales consultant at Covert Buick GMC
Frank Massey facebook profile
Frank Massey, Frank-Massey
Lives in Lahore, Pakistan
Went to St. Mary's High School
St. Mary's High School
Frank Massey facebook profile
Frank Massey, frank.massey.18
Worked at Gompers Prepatory Academy
Studied at University of Alaska Fairbanks
University of Alaska Fairbanks
Frank Massey facebook profile
Frank Massey, autoinform
Lives in Preston, Lancashire
Diagnostic Expert at Automotive Diagnostic Solutions, Preston and Autoinform Online Magazine
Frank Massey facebook profile
Frank Massey, frank.massey.98
Lives in Bridgewater, Nova Scotia
Bridgewater, Nova Scotia
Frank Massey facebook profile
Frank Massey
Supervisor at Massey Enterprise
Studied Computer Information Systems at Kansas City Kansas Community College '13
CEO/Lead Consultant at FJLM
Frank Massey facebook profile
Frank Massey, frank.massey.737
Lives in Lahore, Pakistan
Went to St.Mary's School
St.Mary's School
Frank Massey facebook profile
Frank Massey
Lives in Houston, Texas
Went to Gunn High School
Works at BETCO Scaffolds
Frank Massey facebook profile
Frank Massey, Frank-Massey
Lives in Cartwright, Oklahoma
Went to Colbert High School
Colbert High School
Frank Massey facebook profile
Frank Massey, frank.massey.906
Former Plant Manager at Stimson Lumber Company
Studied Business Administration at University of Phoenix '07
University of Phoenix
Frank Massey facebook profile
Frank Massey, frank.massey1
Lives in Manchester, United Kingdom
Manchester, United Kingdom
Frank Massey facebook profile
Frank Massey, frank.massey.1004
Lives in Cartwright, Oklahoma
Went to Colbert High School
Kitchen at Chuck E. Cheese's
Frank Massey facebook profile
Frank Massey, frank.massey.75
Worked at Mitchell Construction Company
Went to High Point High School '56
High Point High School
Frank Massey facebook profile
Frank Massey
Lives in Scotia, New York
Works at Insurance Agency
Francis Massey (Frank Massey) facebook profile
Francis Massey (Frank Massey), francis.matthews.982
Self-employed
Frank Massey facebook profile
Frank Massey, frank.massey.12
Lives in Cartwright, Oklahoma
Went to Colbert High School '02
Colbert High School

Frank Massey LinkedIn Profiles

Frank Massey linkedin profile
Frank Massey
Pastoral Minister at Jamestown Friends Meeting
Higher Education
Greensboro/Winston-Salem, North Carolina Area
Frank Massey linkedin profile
Frank Massey
Firefighter/Captain at City of Garland
Government Administration
Cleburne, Texas
Frank Massey linkedin profile
Frank Massey
Experienced Workforce, Operations and Business Management leader
Outsourcing/Offshoring
Charleston, West Virginia Area
Frank Massey linkedin profile
Frank Massey
Senior R & D Technologist at Goulston Technologies, Inc
Chemicals
Charlotte, North Carolina Area
Frank Massey linkedin profile
Frank Massey
Teacher of English language learners at The Bement School
Writing and Editing
Amherst, Massachusetts
Frank Massey linkedin profile
Frank Massey
United States
Frank Massey linkedin profile
Frank Massey
Independent Real Estate Professional
Real Estate
Greensboro/Winston-Salem, North Carolina Area
Frank Massey linkedin profile
Frank Massey
Independent Real Estate Professional
Real Estate
Richmond, Virginia Area
Frank Massey linkedin profile
Frank Massey
Regional Sales Manager
Telecommunications
Greater Denver Area
Frank Massey linkedin profile
Frank Massey
United States
Frank Massey linkedin profile
Frank Massey
Conn's Home Plus
Retail
Aurora, Colorado
Frank Massey linkedin profile
Frank Massey
Student at University of South Alabama
Mobile, Alabama
Frank Massey linkedin profile
Frank Massey
United States
Frank Massey linkedin profile
Frank Massey
Manager at TY Danjuma Family Office
Financial Services
Hickory, Mississippi
Frank Massey linkedin profile
Frank Massey
S.C.A.R., INC.
Financial Services
San Antonio, Texas
frank massey linkedin profile
frank massey
Education Management Professional
Education Management
Castle Rock, Colorado
frank massey linkedin profile
frank massey
supervisor at glove factory
Health, Wellness and Fitness
Pascagoula, Mississippi
Massey Frank linkedin profile
Massey Frank
United States
Massey Frank linkedin profile
Massey Frank
Associate Professor of Mathematics at University of MichiganDearborn
Higher Education
Greater Detroit Area

Frank Massey addresses, contacts, age, possible relatives

Name
Born in
Address
Contacts
Possible Relatives
Frank Lee Massey
Born in 1944
708 Aspen Dr,Little Rock, AR 72211

Former addresses
4324 Arehart Dr, Little Rock, AR 72209
16411 Ironton Rd, Little Rock, AR 72206
None, Little Rock, AR 72211
(501) 219-9350

Former phone numbers
(501) 219-9350
(501) 224-7801
(501) 221-2807
(501) 888-7423
Kristen Lee Dillman
Alicia Ceron Massey
Frank D Massey
Born in 1953
581 Boxwood Way,Newport, TN 37821

Former addresses
54 PO Box, Newport, TN 37822
54 RR 4, Newport, TN 37821
(423) 623-6848

Former phone numbers
(423) 623-6848
Frank Hayes Massey
Born in 1936
727 Pecos Rv Ln,Bellville, TX 77418

Former addresses
315 PO Box, Hockley, TX 77447
RR 1, Hockley, TX 77447
27223 Holly Dr, Hockley, TX 77447
RR 1 BIG OAK MHP ##45, Hockley, TX 77447
RR 1 CNTY #1311, Hockley, TX 77447
315 RR 1, Hockley, TX 77447
(409) 372-2785

Former phone numbers
(936) 931-1065
Frank P Massey
Born in 1967
3013 Dobbs Cir,Montgomery, AL 36116

Former addresses
366 Burgwyn Rd, Montgomery, AL 36105
4812 Park Towne Way #160, Montgomery, AL 36116
4827 Park Towne Way #12, Montgomery, AL 36116
339 Delano Ave, Montgomery, AL 36105
(334) 284-5114

Former phone numbers
(334) 284-5114
(334) 281-7030


Possible e-mails
frank6536116@bright.net, frank6536116@yahoo.com
Lela Mae Massey
Dexter B Massey
Teresa A Holley
Frank Massey
Born in 1949
624 Arkansas Highway 56,Ash Flat, AR 72513

Former addresses
624 Ar Hwy, Ash Flat, AR 72513
211 PO Box, Ash Flat, AR 72513
Route 1 #210, Ash Flat, AR 72513
261 Lakeshore Dr, Cherokee Village, AR 72529
210 PO Box, Ash Flat, AR 72513
(870) 994-7460

Possible e-mails
frank_4774@yahoo.com, kjmassey@iwon.com
Kevin Lee Massey
Kristopher J Massey
Lela M Massey
Kris Massey
Shirley J Massey
Kristopher Joseph Massey
Frank A Massey
Born in 1920
528 Idlewood Dr #RR5,Mount Juliet, TN 37122

Former addresses
147 Longford Dr, Rochester Hills, MI 48309
(615) 758-8730

Former phone numbers
(615) 758-8730
(615) 406-7868


Possible e-mails
jersof@aol.com, jersof@ibm.net
Frank Thomas Massey
Born in 1956
185 Cook Rd,Mansfield, OH 44907

Former addresses
76 Harriette Rd, East Falmouth, MA 02536
1527 PO Box, North Falmouth, MA 02556
123 Vennum Ave #1, Mansfield, OH 44903
17 Randolph St, Teaticket, MA 02536
24 Sandwich Rd, Teaticket, MA 02536
556 Freedom Ct #29, Mansfield, OH 44904
1346 Bella Vista St, Mansfield, OH 44904
(419) 774-0626

Former phone numbers
(508) 540-8638
Frank Massey
30 Harriet Dr,Princeton, NJ 08540

Former addresses
300 Elm Rd #224, Princeton, NJ 08540
(609) 924-1586
Frank W Massey
Born in 1933
Grassy Brk,Newfane, VT 05345

Former addresses
RR 1 DEERE, Newfane, VT 05345
340 PO Box, Newfane, VT 05345
343 RR 1, Brookline, VT 05345
340 RR 1, Brookline, VT 05345
343 PO Box, Brookline, VT 05345
Grassy Brook Rd, Newfane, VT 05345
79 Madison St, Dedham, MA 02026
(802) 365-4716
Penelope P Massey
Frank T Massey
Born in 1925
850 Tartan Dr #850,Venice, FL 34293

Former addresses
3216 Chellington Dr #107, Johnsburg, IL 60051
810B Pinebrook Rd, Venice, FL 34285
456113 Covenant, Gurnee, IL 60031
5022 Westwood Dr, Mchenry, IL 60051
4563 Covenant Ct, Gurnee, IL 60031
388 Eden Dr, Englewood, FL 34223
5022 Westwood Dr, Mchenry, IL 60050
909 Golf Rd, Libertyville, IL 60048
(941) 493-3149

Former phone numbers
(941) 474-5344
(847) 249-8130
(941) 362-1566


Possible e-mails
frank_massey2001@yahoo.com
Eli Massey
Frnak Massey
Elizabeth E Massey
Joanne E Massey
Frank W Massey
Born in 1961
103 State St,Amherst, MA 01002

Former addresses
990 Pleasant St #G7, Amherst, MA 01002
22 Lessey St, Amherst, MA 01002
50 Hawthorne St, Westwood, MA 02090
676 PO Box, Amherst, MA 01004
599 Pleasant St, Amherst, MA 01002
1040 Pleasant St #274, Amherst, MA 01002
657 Pleasant St, Amherst, MA 01002
(413) 549-5335

Former phone numbers
(413) 549-4202
(413) 549-9919
(413) 253-9170
(413) 549-9919
(413) 549-5335
(413) 253-9149
Frank T Massey
Born in 1956
52 Amphibian Rd,East Falmouth, MA 02536
Frank E Massey
Born in 1934
4636 Lane Rd,Zephyrhills, FL 33541

Former addresses
1712 10th Ct, Fort Lauderdale, FL 33312
981 PO Box, Zephyrhills, FL 33539
509 PO Box, Zephyrhills, FL 33539
1719 5th St, Fort Lauderdale, FL 33301
(813) 782-1967

Former phone numbers
(813) 541-3093
(305) 527-5845
(813) 788-4938
(954) 782-1967
Frank L Massey
3902 Wesley Dr,Montgomery, AL 36111

Former addresses
876 Grove St, Montgomery, AL 36104
898 Union Cir, Montgomery, AL 36104
Frank W Massey
Born in 1909
1350 Portofino Dr #T109,Sarasota, FL 34242

Former addresses
6367 84th Ln, Ocala, FL 34476
8653 96th St #B, Ocala, FL 34481
(941) 349-8798

Former phone numbers
(941) 922-8452
Frank M Massey
Born in 1909
1271 Highway 1,Greenville, MS 38701

Former addresses
1271 Hwy, Greenville, MS 38701
(662) 334-3441
Frank D Massey
Born in 1958
3299 Highway 80,Brandon, MS 39042

Former addresses
975 Hwy, Brandon, MS 39042
165 RR 1, Brandon, MS 39042
975 Government St, Brandon, MS 39042
Transferred, Gary, IN 46300
80 Hwy, Brandon, MS 39042
Brandon Ms #80, Brandon, MS 39042
165 PO Box, Brandon, MS 39043
80 Highway, Brandon, MS 39042
(601) 467-7059

Former phone numbers
(601) 825-9442
Sarah M Massey
Joseph F Massey
Sonja Fox Massey
Sonja F Nmassey
Frank N Massey
Born in 1924
521 PO Box,Goshen, NJ 08218

Former addresses
463 Route 47, Goshen, NJ 08218
4 Jacobstown Arneytown, Goshen, NJ 08218
4 Jacobstown Arneytown Rd, Goshen, NJ 08218
41 Vernon Ct, Goshen, NJ 08218
41 Vernon, Goshen, NJ 08218
10 2nd Dr, Stone Harbor, NJ 08247
117 Arlington Ave, Collingswood, NJ 08107
526 PO Box, Goshen, NJ 08218
22 Valley Dr, Landenberg, PA 19350
117 Arlington Ave, Oaklyn, NJ 08107
463 State Route 47, Goshen, NJ 08218
8 2nd Dr, Stone Harbor, NJ 08247
(609) 465-5429

Former phone numbers
(609) 368-5567
Frank Massey
420 13th St,New York, NY 10009

Former addresses
352 18th St #4B, New York, NY 10011
Frank Russell Massey
Born in 1966
382 Christy Ln,Benton, AR 72015

Former addresses
27469 Southland Dr, Splendora, TX 77372
8015 Rice Rd #B, Dickinson, TX 77539
519 Shawnee St, Houston, TX 77034
4713 Pine St, Seabrook, TX 77586
1109 PO Box, Seabrook, TX 77586
(281) 399-8882
Sharon K Hyatt
Scott R Massey
Patricia Ann Isommassey
Frank L Massey
2048 Fairview Ave #216,Montgomery, AL 36108

Former addresses
1019 Day Street Rd #A, Montgomery, AL 36108
4373 Burnsdale, Montgomery, AL 36108
4373 Burnsdale Wa, Montgomery, AL 36108
(334) 832-4389

Former phone numbers
(334) 281-0816
Frank Estes Massey
Born in 1928
1913 Main St,El Dorado, AR 71730
(870) 862-5029

Former phone numbers
(870) 862-5029
Jr Franke Massey
Louise W Massey

Associated names
Frank W Massey, Frank E Jr Massey, Frank E Nassey, Frank E Massey Jr
Frank H Massey
Born in 1912
9 31st St,Long Beach Township, NJ 08008

Former addresses
410 Coral St, Beach Haven, NJ 08008
905 Bay Ave, Beach Haven, NJ 08008
(610) 664-8081
Frank Putney Massey
Born in 1934
332 Lee Road 219,Phenix City, AL 36870

Former addresses
75 RR 4, Albany, GA 31705
4 RR 4, Albany, GA 31705
75 Tanglewood Dr, Albany, GA 31705
322 Lee #219, Phenix City, AL 36867
2008 PO Box, Robertsdale, AL 36567
75 RR 4 POB, Albany, GA 31705
90 Whiterock Rd, Phenix City, AL 36869
(334) 297-6782

Former phone numbers
(334) 297-6782
(334) 297-7820
(229) 776-5229
Melinda D Zielinski
Raymond K Massey
Rosemary Massey
Shelley D Massey
Haley Massey
Anna M Massey
E Massey
Edna Ann Massey
Sheri Massey

Associated names
Frank P Massey
Frank E Massey
Born in 1951
1818 Roosevelt St,Huntsville, TX 77320
(936) 435-0788

Former phone numbers
(936) 435-0788
(936) 436-1797
(936) 291-7503
Oscar Massey
Janie Massey Smith
Myra B Massey
Bonnie Kelly Massey

Frank Massey Addresses, Phone Numbers

Name
Address
County
Phone
Frank Massey
1029 MOUNT ZION RD, FALKVILLE, AL, 35622
MORGAN
(256) 784-5451
Frank Massey
3998 ASHCROFT AVE, CASTLE ROCK, CO, 80104
DOUGLAS
(303) 663-6037
Frank Massey
182 LEE ROAD 2074, SALEM, AL, 36874
LEE
Frank Massey
13702 14TH ST APT 14, DADE CITY, FL, 33525
PASCO
(352) 567-1553
Frank Massey
PO BOX 2543, JUPITER, FL, 33468
PALM BEACH
(561) 748-4650
Frank Massey
7607 WOODRIDGE WAY, GRANITE BAY, CA, 95746
PLACER
Frank Massey
1001 E BAYAUD AVE, DENVER, CO, 80209
DENVER
Frank Massey
850 TARTAN DR, VENICE, FL, 34293
SARASOTA
(941) 493-3149
Frank Massey
3998 ASHCROFT AVE, CASTLE ROCK, CO, 80104
DOUGLAS
(303) 663-6037
Frank Massey
45333 12TH ST W, LANCASTER, CA, 93534
LOS ANGELES
Frank Massey
495 HICKS ST APT 4N, MONTEVALLO, AL, 35115
SHELBY
(205) 665-4261
Frank Massey
1404 KAVANAUGH BLVD, LITTLE ROCK, AR, 72205
PULASKI
(501) 663-0080
Frank Massey
3013 DOBBS CIR, MONTGOMERY, AL, 36116
MONTGOMERY
(334) 284-5114
Frank Massey
52 WARREN ST, NEW LONDON, CT, 6320
NEW LONDON
(860) 447-8001
Frank Massey
24002 E JAMISON DR, AURORA, CO, 80016
ARAPAHOE
(303) 484-9201
Frank Massey
3469 W GOLDMINE MOUNTAIN CV, QUEEN CREEK, AZ, 85242
MARICOPA
(480) 641-0194
Frank Massey
9949 SILVER MAPLE RD, LITTLETON, CO, 80129
DOUGLAS
Frank Massey
3710 34TH AVE, NORTHPORT, AL, 35473
TUSCALOOSA
Frank Massey
PO BOX 2543, JUPITER, FL, 33468
PALM BEACH
(561) 748-4650
Frank Massey
4636 LANE RD, ZEPHYRHILLS, FL, 33541
PASCO
(813) 782-1967
Frank Massey
624 ARKANSAS HIGHWAY 56, ASH FLAT, AR, 72513
SHARP
(870) 994-7460
Frank Massey
3469 W GOLDMINE MOUNTAIN CV, QUEEN CREEK, AZ, 85242
MARICOPA
(480) 641-0194
Frank Massey
2914 BAILEY AVE, PUNTA GORDA, FL, 33950
CHARLOTTE
Frank Massey
4286 PALM AVE, SAN DIEGO, CA, 92154
SAN DIEGO
Frank Massey
52 WARREN ST, NEW LONDON, CT, 6320
NEW LONDON
(860) 447-8001

Frank Massey's Real Estate

Name
Owner Address
Real Estate Address
Value
Year of construction
MASSEY FRANKIE L
1417 BASIN ST, WINTER GARDEN, FLORIDA 34787
Real Estate Address
1417 BASIN ST, WINTER GARDEN, FL 34787
Value $46,291
Year of construction 1982
MASSEY FRANK E & JOANNE & SWM
Real Estate Address
2914 BAILEY AVE, PUNTA GORDA, FL 33950
MASSEY FRANK E & JOANNE & SWM
Real Estate Address
2912 BAILEY AVE, PUNTA GORDA, FL 33950

Frank Massey in Car Registration Database

Name
Address
Phone
Car Model
VIN
Frank Massey
624 Arkansas Highway 56, Ash Flat, AR 72513-9638
(870) 994-7460
Car Model 2011 FORD FLEX
VIN 2FMGK5CC9BBD35895
Frank Massey
4917 BAY BRIDGE DRIVE, FLOWOOD, MS 39232
(601) 750-3381
Car Model 2012 NISSAN SENTRA
VIN 3N1AB6AP0CL662930
Frank Massey
10601 CLOISTER DR, HENRICO, VA 23238-3453
Car Model 2010 CHEVROLET SILVERADO 1500
VIN 3GCRKSE38AG238157
Frank Massey
11733 BEDOUIN CT, EL PASO, TX 79934-3172
Car Model 2009 HONDA ACCORD
VIN 1HGCP26829A012080
Frank Massey
1912 E 70th St, Cleveland, OH 44103-4022
Car Model 2009 FORD FUSION
VIN 3FAHP07Z39R219461
Frank Massey
3299 Highway 80 E, Brandon, MS 39042-7774
Car Model 2012 FORD ESCAPE
VIN 1FMCU0DG7CKA81446
Frank Massey
2816 S Highway 281, Mineral Wells, TX 76067-1452
Car Model 2008 JEEP WRANGLER UNLIMITED
VIN 1J4GA39198L578496
Frank Massey
PO Box 703, Westminster, CO 80036-0703
(303) 722-1061
Car Model 2012 HYUNDAI VERACRUZ
VIN KM8NUDCC3CU195818
Frank Massey
405 W Highlands Dr, Superior, AZ 85173-4542
Car Model 2009 FORD F-350 SUPER DUTY
VIN 1FTWW31R09EA81735
Frank Massey
124 E 15TH ST, IRVING, TX 75060-6030
Car Model 2011 DODGE GRAND CARAVAN
VIN 2D4RN3DG6BR663537
Frank Massey
3759 ARMINTO DR, ELLENWOOD, GA 30294-6663
Car Model 2011 JEEP LIBERTY
VIN 1J4PN2GK1BW558825
Frank Massey
11232 PINE HILL RD, KING GEORGE, VA 22485-4610
Car Model 2008 DODGE CHARGER
VIN 2B3KA43R98H173855
Frank Massey
2816 S Highway 281, Mineral Wells, TX 76067-1452
(940) 325-1877
Car Model 2008 DODGE RAM PICKUP 2500
VIN 3D3KS28A68G224464
Frank Massey
710 Crooks Rd, Westminster, SC 29693-4945
(864) 647-7000
Car Model 2008 DODGE RAM PICKUP 3500
VIN 3D7ML48A98G146553
Frank Massey
605 Jan Dr, Mendenhall, MS 39114-3041
(601) 847-0635
Car Model 2012 HONDA CR-V
VIN 5J6RM3H76CL010155
Frank Massey
1331 Chestnut Rd, Mansfield, TX 76063-2522
(817) 473-0872
Car Model 2007 Plymouth Voyager 3dr SE 113 WB
VIN 1UJBJ02R3718C0364
Frank Massey
449 Guthries Grn, Shacklefords, VA 23156-2035
(804) 364-0429
Car Model 2011 TOYOTA AVALON
VIN 4T1BK3DB2BU386878
Frank Massey
28 Red Oak Dr, Schenectady, NY 12302-3033
(518) 370-0390
Car Model 2011 HYUNDAI SANTA FE
VIN 5XYZKDAG4BG089413

Frank Massey in Company Registration Database

Name
Company Name
Company Address
Position
Creation Date
Company Status
FRANK L MASSEY
117 CACTUS PEAR , BOERNE TX 78006
Position SECRETARY
FRANK MASSEY
76 HARRIETTE ST.,, FALMOUTH
Position TREASURER
Frank L Massey
7240 ROLLING ACRES TRAIL , Fair Oaks Ranch TX 78015
Position Director
FRANK L MASSEY
117 CACTUS PEAR , BOERNE TX 78006
Position TREASURER
FRANKIE MASSEY
2816 S HIGHWAY 281 , MINERAL WELLS TX 76068
Position PRESIDENT
FRANK MASSEY
76 HARRIETTE ST.,, FALMOUTH
Position PRESIDENT
FRANKLIN D MASSEY
PO BOX 330 , PORT ARANSAS TX 78373
Position PTR
FRANK L MASSEY
7240 ROLLING ACRES TRAIL , Fair Oaks Ranch TX 78015
Position PRESIDENT
FRANK MASSEY
117 CACTUS PEAR , BOERNE TX 78006
Position DIRECTOR
FRANK L MASSEY
117 CACTUS PEAR , BOERNE TX 78006
Position DIRECTOR
Frank L Massey
7240 ROLLING ACRES TRAIL , Fair Oaks Ranch TX 78015
Position P/S/T
FRANK L MASSEY
7240 ROLLING ACRES TRAIL , Fair Oaks Ranch TX 78015
Position Director
Franklin L. Massey
7520 Rolling Acres Trail , Fair Oaks Ranch TX 78015
Position Manager

Frank Massey Marketing Data

Name, Address, Phone
Marketing Data
Mr. Frank R Massey
184 Mann St Bridge City TX 77611 -2708
(409) 313-6221
Range of new credit: $3,001 - $5,000
Education: Completed High School
Ethnic group: Western European
Mr. Frank Massey
1506 Dupont Dr Orange TX 77630 -7406
(409) 883-8920
Income - estimated household: $10,000 - $14,999
Range of new credit: $3,001 - $5,000
Education: Completed High School
Ethnic group: Western European
Mr. Frank Massey
2625 Highway 37 Columbiana AL 35051 -5367
(205) 669-2246
Income - estimated household: $45,000 - $49,999
Estimated net worth: $10,000 - $24,999
Range of new credit: $3,001 - $5,000
Education: Completed Graduate School
Ethnic group: Western European
Mr. Frank Massey
6614 Bandalia Dr Rowlett TX 75089-7155 -7155
(972) 412-3163
Income - estimated household: $100,000 - $149,999
Estimated net worth: $250,000 - $499,999
Range of new credit: $3,001 - $5,000
Education: Completed High School
Ethnic group: Western European
Mr. Frank Massey
42694 285th St Olivet SD 57052 -6515
(605) 387-2824
Home owner source: Verified Home Owner
Income - estimated household: $50,000 - $54,999
Estimated net worth: $1 - $4,999
Range of new credit: $3,001 - $5,000
Education: Completed High School
Ethnic group: Western European
Mr. Frank W Massey
45333 12th St W Lancaster CA 93534 -1708
(661) 202-5882
Home owner source: Verified Home Owner
Income - estimated household: Under $10,000
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 6 Lines
Range of new credit: Greater than $9,999
Education: Completed College
Ethnic group: Western European
Mr. Frank W Massey
6321 Sue Page Dr Tallahassee FL 32310 -1155
(850) 576-3347
avonntally@yahoo.com
Income - estimated household: $40,000 - $44,999
Estimated net worth: $1 - $4,999
Range of new credit: Greater than $9,999
Education: Completed College
Ethnic group: Western European
Mr. Frank W Massey
12124 Back Creek Rd Bishopville MD 21813 -1732
(410) 352-5110
Home owner source: Verified Home Owner
Income - estimated household: $35,000 - $39,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $5,001 - $9,999
Education: Completed Graduate School
Ethnic group: Western European
Mr. Frank Massey
616 Yieda Dr Festus MO 63028 -1160
(636) 575-2198
Home owner source: Highly Likely Home Owner
Income - estimated household: $50,000 - $54,999
Estimated net worth: $50,000 - $99,999
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Frank A Massey
768 E Garden Rd Vineland NJ 08360 UNIT 112-1748
(856) 691-8218
Home owner source: Highly Likely Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 2 Lines
Range of new credit: Greater than $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Frank Massey
3525 Mcgehee Place Ct S Montgomery AL 36111 -3339
(334) 233-6215
teresa.massey@yahoo.com
Home owner source: Verified Home Owner
Income - estimated household: $50,000 - $54,999
Estimated net worth: $25,000 - $49,999
Lines of credit (trade counter): 3 Lines
Range of new credit: $501 - $1,000
Education: Completed High School
Ethnic group: Western European
Mr. Frank C Massey
Po Box 2368 Orange Beach AL 36561 -2368
(251) 269-0538
masseyccm@gulftel.com
Home owner source: Verified Home Owner
Income - estimated household: $55,000 - $59,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 4 Lines
Range of new credit: $3,001 - $5,000
Education: Completed Graduate School
Ethnic group: Western European
Mr. Frank Massey
624 Arkansas Highway 56 Ash Flat AR 72513 -9638
(870) 994-7460
kevinlmassey1@swbell.net
Home owner source: Verified Home Owner
Income - estimated household: $30,000 - $34,999
Estimated net worth: $50,000 - $99,999
Range of new credit: $5,001 - $9,999
Education: Completed Graduate School
Ethnic group: Western European
Mr. Frank E Massey
24002 E Jamison Dr Aurora CO 80016 -1314
(303) 898-8315
Home owner source: Verified Home Owner
Income - estimated household: $250,000 +
Estimated net worth: Greater than $499,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Frank A Massey
3998 Ashcroft Ave Castle Rock CO 80104 -8759
(303) 663-6037
frank.massey@juno.com
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $250,000 - $499,999
Range of new credit: Greater than $9,999
Education: Completed Graduate School
Ethnic group: Western European
Mr. Frank L Massey
50 Briarwood Dr Windsor CT 06095 -3937
(860) 527-9497
Home owner source: Verified Home Owner
Income - estimated household: $60,000 - $64,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Frank Massey
30913 Sealine Dr Leesburg FL 34748 -9195
(352) 787-9636
lisamasters79@yahoo.com
Home owner source: Verified Home Owner
Income - estimated household: $15,000 - $19,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $3,001 - $5,000
Education: Completed Graduate School
Ethnic group: Western European
Mr. Frank E Massey
4636 Lane Rd Zephyrhills FL 33541 -3500
(813) 782-1967
masseyscott@worldnet.att.net
Home owner source: Verified Home Owner
Income - estimated household: $50,000 - $54,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 5 Lines
Range of new credit: $5,001 - $9,999
Education: Completed Graduate School
Ethnic group: Western European
Mr. Frank C Massey
1306 E Troy St Greensburg IN 47240 -2232
(812) 663-3233
Home owner source: Highly Likely Home Owner
Income - estimated household: $150,000 - $174,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 3 Lines
Range of new credit: $3,001 - $5,000
Education: Completed High School
Ethnic group: Western European
Mr. Frank Massey
109 Poplar Dr Brandon MS 39047 -6231
(601) 992-2722
emelon1@excite.com
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 2 Lines
Range of new credit: Greater than $9,999
Education: Completed College
Ethnic group: Western European
Mr. Frank D Massey
3299 Highway 80 E Brandon MS 39042 -7774
(601) 825-9442
josephm4664@aol.com
Home owner source: Verified Home Owner
Income - estimated household: $45,000 - $49,999
Estimated net worth: $100,000 - $249,999
Range of new credit: Greater than $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Frank E Massey
28 Red Oak Dr Schenectady NY 12302 -3033
(518) 370-0390
ejca555@nycap.rr.com
Home owner source: Verified Home Owner
Income - estimated household: $60,000 - $64,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $5,001 - $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Frank Massey
1912 E 70th St Cleveland OH 44103 -4022
(216) 432-3013
frankiemassey@comcast.net
Home owner source: Verified Home Owner
Income - estimated household: Under $10,000
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $3,001 - $5,000
Education: Completed High School
Ethnic group: All African American Ethnic Groups
Mr. Frank H Massey
27223 Holly Dr Hockley TX 77447 -5136
(936) 931-1820
Home owner source: Verified Home Owner
Income - estimated household: $60,000 - $64,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 2 Lines
Range of new credit: Greater than $9,999
Education: Completed College
Ethnic group: Western European
Mr. Frank N Massey
2725 Goode Rd Goode VA 24556 -2671
(540) 586-1339
Home owner source: Highly Likely Home Owner
Income - estimated household: $65,000 - $74,999
Estimated net worth: Greater than $499,999
Lines of credit (trade counter): 5 Lines
Range of new credit: $3,001 - $5,000
Education: Completed College
Ethnic group: Western European
Mr. Frank W Massey
2634 Colonial Pkwy Dayton OH 45434 -6288
(937) 427-7804
charlenemassey@hotmail.com
Home owner source: Verified Home Owner
Income - estimated household: $250,000 +
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 5 Lines
Range of new credit: $3,001 - $5,000
Education: Completed Graduate School
Ethnic group: Western European
Mr. Frank L Massey
8200 Sw Woodbridge Ct Wilsonville OR 97070 -9427
(503) 694-0150
kumcpa@hotmail.com
Home owner source: Verified Home Owner
Income - estimated household: $200,000 - $249,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 5 Lines
Range of new credit: $5,001 - $9,999
Education: Completed College
Ethnic group: Western European
Mr. Frank A Massey
3953 Betty Ln Cleburne TX 76031 -0001
(817) 996-4756
fmassey@nc.rr.com
Home owner source: Verified Home Owner
Income - estimated household: $100,000 - $149,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $5,001 - $9,999
Education: Completed Graduate School
Ethnic group: Western European
Mr. Frank K Massey
730 Deleon St Denison TX 75020 -3858
(903) 465-6096
fmassey@cfl.rr.com
Home owner source: Verified Home Owner
Income - estimated household: $100,000 - $149,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 3 Lines
Range of new credit: $5,001 - $9,999
Education: Completed College
Ethnic group: Western European
Mr. Frank T Massey
124 E 15th St Irving TX 75060 -6030
(972) 251-2227
superrebelbutterfly@aol.com
Home owner source: Verified Home Owner
Income - estimated household: $45,000 - $49,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 3 Lines
Range of new credit: $5,001 - $9,999
Education: Completed High School
Ethnic group: Western European

Frank Massey Whois Records

Domain
Registrar Data
creeksideeaglebend.com
creeksidehoa@centurylink.net
Whois sever: whois.godaddy.com
Create / update date: 02-feb-2013 / 16-mar-2013
GODADDY.COM, LLC
712 S. Pearl Street Denver Colorado 80209, UNITED STATES
howtowriteascreenplaymadesimple.info
coachfrank@centurylink.net
Create / update date: 28-May-2013 16:49:06 UTC / 27-Jul-2013 20:31:02 UTC
GoDaddy.com, LLC (R171-LRMS)
24002 E. Jamison Drive Aurora Colorado 80016, UNITED STATES
17202036237
quicktimeproducts.com
COACHFRANK@CENTURYLINK.NET
Whois sever: whois.enom.com
Create / update date: 27-dec-2012 / 27-dec-2012
ENOM, INC.
24002 E. JAMISON DRIVE AURORA COLORADO 80016, UNITED STATES
american512.com
coachfrank@centurylink.net
Whois sever: whois.register.com
Create / update date: 16-nov-2013 / 16-nov-2013
REGISTER.COM, INC.
24002 E. Jamison Drive Aurora CO 80016, UNITED STATES
13038984357
cardinalfloorsanding.com
fmassey54@yahoo.com
Whois sever: whois.tucows.com
Create / update date: 05-sep-2013 / 05-sep-2013
TUCOWS DOMAINS INC.
556 freedom ct mansfield OH 44904, UNITED STATES
419 756 6356
firefighterinflatables.com
wu6z98453t7@networksolutionsprivateregistration.com
Whois sever: whois.networksolutions.com
Create / update date: 11-sep-2009 / 13-jul-2013
NETWORK SOLUTIONS, LLC.
PO Box 459 Drums PA 18222, UNITED STATES
5707088780
frankmassey.com
frankmassey@outlook.com
Whois sever: whois.networksolutions.com
Create / update date: 15-feb-2004 / 17-dec-2012
NETWORK SOLUTIONS, LLC.
3953 Betty Lane Cleburne TX 76031, UNITED STATES
8179964756

Frank Massey in US Voter Database

Name
Address
Phone
E-mail
Party
Frank Massey
1912 EAST 70TH, CLEVELAND, OH, 44103
(216) 990-3967
masseyfrankie@yahoo.com
Independent
Frank Massey
28 RED OAK DR, SCOTIA, NY, 12302
(518) 225-1868
fmassey@yahoo.com
Frank Massey
1912 E 70TH ST, CLEVELAND, OH, 44103
(216) 990-3967
masseyfrankie1@yahoo.com
Frank Massey
1912 E 70TH ST, CLEVELAND, OH, 44103
(216) 383-9117
fmassey@cox.net
Independent
Frank Massey
45333 12TH ST W, LANCASTER, CA, 93534
(805) 490-6795
frank.massey@qwest.net
Independent
Frank Massey
1417 BASIN ST., WINTER GARDEN, FL, 34787
(407) 656-9351
masseyfl2086@aol.com
Frank Massey
11 CLOVER COURT, HOULTON, ME, 4730
(207) 532-6248
fmassey@aol.com
Republican
Frank Massey
528 IDLEWOOD DR, MOUNT JULIET, TN, 37122
(615) 406-7868
fmassey@rcn.com
Frank Massey
7594 FM 1753, DENISON, TX, 75021
(903) 517-4743
franklin.massey@netzero.net
Frank Massey
45333 12TH ST W, LANCASTER, CA, 93534
(805) 490-6795
frank.massey@aol.com
Republican


People Finder Catalog

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z 


0.027 s.