Raleigh Prince - we found 65 people search records: 5 addresses & phone numbers, 2 Raleigh Prince's cars, 56 CVs and social profiles

3 Raleigh Prince's phone numbers & addresses

Name
Address
County
Phone
Raleigh Prince
24039 ROCKYGATE DR, SPRING, TX, 77373
HARRIS
(281) 288-1074
Raleigh Prince
5580 MOUSE CREEK RD NW, CLEVELAND, TN, 37312
BRADLEY
(423) 339-5675
Raleigh Prince
13725 CAMBURY DR APT 902, HOUSTON, TX, 77014
HARRIS

2 VINs of Raleigh Prince's cars

Name
Address
Phone
Car Model
VIN
Raleigh Prince
3066 LOWER RIVER RD NW, GEORGETOWN, TN 37336
Car Model 2008 MAZDA MAZDA3
VIN JM1BK343381181089
Raleigh Prince
959 BEGO RD, GOLIAD, TX 77963-3689
Car Model 2007 TOYOTA CAMRY
VIN JTNBE46K273077208

2 Raleigh Prince's home addresses and relatives

Name
Address
Contacts
Possible Relatives
Raleigh Brain Prince
5580 Mouse Creek Rd,Cleveland, TN 37312
Former addresses:
2300 34th St #822, Grand Forks, ND 58201
2300 34th St #814, Grand Forks, ND 58201
2928 Benton #22, Cleveland, TN 37312
155 Phillips Dr, Cleveland, TN 37312
3356 PO Box, Grand Forks, ND 58207
3356 Po, Grand Forks, ND 58207
165 Phillips Dr, Cleveland, TN 37312
(423) 339-5675
Former phone numbers:
(615) 559-8948
(423) 339-5675
(423) 336-6912
(423) 322-9471
Possible relatives
Seth Prince, Kellie M Prince, Raleigh B Prince, Sarah Prince
Raleigh Prince
2605 Prince St,Victoria, TX 77901
Former addresses:
311 Williamsburg Ave, Victoria, TX 77904
1806 Red River St, Victoria, TX 77901
308 Fernwood Cir, Victoria, TX 77901
610 Baass Ln, Victoria, TX 77905
101 Tern Ct, Victoria, TX 77901
2507 Prince St, Victoria, TX 77901
(361) 485-9559
Former phone numbers:
(512) 578-9156
(512) 573-3185
(361) 485-9559
(361) 550-8352
(361) 573-6851
(361) 573-6851
Possible relatives
Raliegh Prince, Hazel King Prince, Shayla Chevon Prince, Betty L Prince, Betty Shelton Prince, Joyce Tyrone Prince, Carl Sr Prince
Associated names
Raleigh Jr Prince, Raleigh Prince, Raleigh Lamont Prince

1 CVs by Raleigh Prince

Raleigh Prince
Firefighter at City of Houston
Government Administration
Houston, Texas Area

Raleigh Prince's net worth and financial records

Name, Address, Phone
Marketing Data
Raleigh Prince
24039 Rockygate Dr Spring TX 77373 -7387
(281) 323-4759
Home owner source: Verified Home Owner
Income - estimated household: $60,000 - $64,999
Estimated Mr. Raleigh L Prince net worth: $25,000 - $49,999
Education: Completed High School
Ethnic group: Western European

55 Raleigh Prince's Social Profiles

John Paul Sevilleno Rola (Payat���)
Facebook: paaaaaNes
From Marikina City
Went to Malanday National High School '15
Boss at i dont have to work because im a prince
Prïnçe Röly
Facebook: rolando.piloguarcax.5
Lives in Guatemala City, Guatemala
Works at en la obra d Dios es la mejorenpresa del mundo
Reila Renata (Reeh )
Facebook: reila.renata.3
Lives in Centralina, Minas Gerais, Brazil
Studied at E.E. Wilson de Melo
Cantora Evangélica at TRABALHO NA OBRA DE DEUS
Prince Rolle
Facebook: prince.rolle.50
Lives in Coleman, Florida
Owner at GoddFather Ent.
Shawn Riley (Pipe)
Lives in Saskatoon, Saskatchewan
Saskatoon, Saskatchewan
Emily Preddy (Princess Amelia)
Lives in Raleigh, North Carolina
Server at Red Monkey Tavern
Cassidy Riley
Former Host // Server at Coyote Blues - Lake Charles, Louisiana
Studies Economics at LSU '19
LSU
Rheily Graham
Facebook: rheily.graham
Lives in Rotorua, New Zealand
Went to Rotorua Girls' High School
Rotorua Girls' High School
Riley Nault
Facebook: riley.nault.9
Lives in Quesnel, British Columbia
Studied at College of New Caledonia
welder/millwright at Royalite Industrial Maintenance Ltd.
Rielly Spratt
Lives in Emsdale, Ontario
Goes to Almaguin Highlands Secondary '18
Works at Dairy Queen
Princess Caprice Raleigh
Facebook: princess.raleigh
From Brighton
Chantay Marie Riley (Chantal)
Lives in Saint John, New Brunswick
Stay-at-home parent
Mommy Duties at Stay-at-home parent
Sean Lambert (Prince Mfkn Bay)
Lives in Memphis, Tennessee
Went to Raleigh-Egypt High School '04
Raleigh-Egypt High School
Prince Raleigh
Facebook: Past.Prince.Raleigh
Lives in Port Harcourt
Port Harcourt
Prince Rowdy (Raleigh)
From Chicago, Illinois
Works at Bands Ova Hoes The Family #BOHTheFamily
Prince Riley
Lives in Amherst, Nova Scotia
Self-employed
Owner at Self-employed
Raylla Dovall (Princesinha Da Mamãe)
Facebook: Raylla.dovall.102
Mimadinha at $.$ MaMãe e PaPai que me Bancão :3
Deborah Riley
Facebook: deborah.riley.587
Lives in Fort Washington, Maryland
Studied Early childhood education at University of Maryland, College Park
Gifted Resource Teacher at Charles County Public Schools
Paul John Sevilleno Rola
Facebook: paneeeees
Worked at i dont have to work because im a prince
Goes to Malanday National High School '19
Malanday National High School
Raleigh Midkiff
Facebook: raleigh.midkiff
Lives in Calvert, Maryland
Went to Patuxent High School '05
Firefighter at DCFD
Sara Rayla (Princesinha)
Facebook: sara.rayla.5
Worked at Não E Da Sua Conta.
Studied at Escola Rodolfo Aureliano
Escola Rodolfo Aureliano
Raleigh B. Prince
Lives in Cleveland, Tennessee
Went to Bradley High School '87
Owner at Prince Heating & Air Conditioning
Royale Sign (Official Account)
Facebook: royale.singh.50
Self-employed
Studied at University of Delhi
Owner at Self-employed
Kel Ramone (Danger Princess)
Facebook: kuruimizu
Musician at Starscraper
Went to Glasgow High School '14
Admin at Fring fre la froggo
Prince Raleigh
Facebook: prince.raleigh
From Cape Coast Castle, Central, Ghana
Rylie Rew
Facebook: rylie.ward.56
Lives in Oshawa, Ontario
Went to center for individual studies
Works at Full Time Mommy
PrinCess HaNna Ruelo
Facebook: PrinCess-HaNna-Ruelo
From Pio V. Corpuz, Masbate
Goes to OVILLA SOUTHERN ACADEMY O.S.A
Works at Work at sa puso ng bhebkoh
Roylee Suriyaworakul (ร้อยลี้)
Facebook: photosunday
Lives in Hat Yai, Thailand
Studied การตลาด at มหาวิทยาลัยสงขลานครินทร์ '00
Owner/Photographer at photosunday tel 0815413625
Princess Riley
Facebook: princess.laelae.92
From Polk City, Florida
Studied at Bethune-Cookman University
Bethune-Cookman University
Roli Roli (PrincessRoli Roli)
Went to LIC.- BENITO JUAREZ, GONZALEZ, TAMPS.
LIC.- BENITO JUAREZ, GONZALEZ, TAMPS.
Prince Raleigh
Facebook: prince.raleigh.1
Lives in Cape Coast, Ghana
Went to Aggrey Memorial A.M.E. Zion Senior High School
Aggrey Memorial A.M.E. Zion Senior High School
Brandy Prince
princemakeup.com
Studied Elementary Education K-6 at University of Memphis '08
Elite Orange Status Presenter at princemakeup.com
Priscilla Riley (Princess Priscilla)
Facebook: elviscristina.dellis
regia
Went to centro stile moda
Works at Produttrice
Gab Rielle (warrior princess)
Lives in Christchurch, New Zealand
Studied Medical Laboratory at Davao Doctors' College
Works at Painter (artist)
Relly Mílan
Facebook: Relly-Mílan
Lives in Brooklyn, New York
Brooklyn, New York
Summer Lorraine (Princess Zelda)
Lives in Raleigh, North Carolina
Street Team Member at Gourmet Collective
Prince Riley
Facebook: Prince-Riley
Lives in Minneapolis, Minnesota
Studied at Minneapolis Community and Technical College
Works at Delaware North
Rolly B Semillano Jr. (Cgm)
Facebook: rollysemillano2
Lives in Biñan City
Studied Ateneo de Manila University at University of Oxford
Model at Instagram
Melody Lael Clore
Lives in Raleigh, North Carolina
Data entry clerk at RTI International
Sales at FYE
Luisitho Rěălě (Marcando la Diferencia )
Facebook: luis.julio.9828
Lives in Arjona
Studied at Cartagena
Software Engineer at Facebook
Marie Dugger
Facebook: anayaprettygirlswagfarmer.farmer
Lives in Raleigh, North Carolina
Works at Doing Hair
Cess Rillo (Princess Jubilee Florentino Rillo)
Facebook: cess.rillo
Lives in Angono, Rizal
Goes to Angono Private High School
Angono Private High School
Prince Riley (Prince Riley)
Lives in Los Angeles, California
CEO at Selfish Ways
Diamond Taylor (Princess)
Facebook: diamond.taylor.735944
Lives in Lumberton, North Carolina
Lumberton, North Carolina
Melita Rully
Facebook: pooncymeelita.melita
Lives in Kuito
Goes to Colégio Marista São José
Colégio Marista São José
Princees Rola
Facebook: Princees-Rola
Lives in Amman, Jordan
Amman, Jordan
Ndifreke Prince Raleigh
Lives in Port Harcourt
Studied at University of uyo(uniuyo) '10
Support Staff at HGA Support Services
Rolly Agarwal (Princes )
Facebook: Rolly-Agarwal
Former CCE at Royal Hyundai Gwalior
Studied BSc Computer Science at K.R.G college Gwalior
K.R.G college Gwalior
Rally Souza (Aysha minha princesa)
Facebook: anny.souzah
Lives in Urucurituba
Studied at Escola Estadual Maria Arruda
Works at Não E Da Sua Conta.
Raleigh Tile Princeton
Facebook: RaleighTilePrinceton
Lives in Princeton, West Virginia
Princeton, West Virginia
Theresa Reilly
Facebook: Theresa-Reilly
Lives in Waterford, Ireland
Went to TOO COOL for School
Works at being a full time mad bastard.
Emma Reilly (Princess Consuela banana hammock)
Facebook: emma.reilly.73744
Steward at Security Scotland Ltd
Went to St Andrews RC High School '10
Bartender at Topstaff Employment
Prince Quasar Royall III
Facebook: Prince-Quasar-Royall-III
Lives in Vallejo, California
Vallejo, California
Princess Darren Millera (The Preachers Daughter)
Facebook: princejohn.cayabyab
Self-employed
Studied at De La Salle John Bosco College
De La Salle John Bosco College
Sha Nang Rala
Facebook: shanang.gonzales.3
Former ��� at Wattpad
Studied at Hell University '17
Hell University

1 Raleigh Prince's websites and domain names

Domain
Registrar Data
princehvac.com registered by Raleigh Prince
prince5436@gmail.com
Create / update date: 24-feb-2012 / 24-feb-2012
Registrar: GODADDY.COM, LLC
5580 Mouse Creek Rd Cleveland Tennessee 37312, UNITED STATES


Types of Data You Can Find


Social Profiles

Business Registration

Education Records

Addresses, Phones

Marketing Data

Whois Records

Contacts, Relatives

Donations Records

Real Estate

Car Registration