Filter
All 159 Facebook 40LinkedIn 8Contacts 25Addresses 25Real Estate 11Cars 12Marketing 19Whois 8Donations 3US Voter 8

Harry Kerr Facebook Profiles

Harry Kerr facebook profile
Harry Kerr, harry.kerr.923
Lives in London, United Kingdom
Studied at Royal Holloway, University of London '13
Royal Holloway, University of London
Harry Kerr facebook profile
Harry Kerr, ahmkerr
Lives in Melbourne, Victoria, Australia
Studied at Trinity College, Dublin
Works at Retired Anglican Priest
Harry Kerr facebook profile
Harry Kerr, harry.kerr.790
Retired
Studied at albert senior secondary school '70
Retired at Retired
Harry Kerr facebook profile
Harry Kerr, harry.kerr.7
Studies at The University of Western Australia
The University of Western Australia
Harry Kerr facebook profile
Harry Kerr, Harry-Kerr
Studies French and German at University of Hull '19
University of Hull
Harry Kerr facebook profile
Harry Kerr
Lives in Troon
Studied Mechanical engineering at Glasgow Caledonian University '16
Summer Student at Jacobs Engineering
Harry Kerr facebook profile
Harry Kerr, harry.kerr.56
Lives in Sydney, Australia
Went to Galston High School
Galston High School
Harry Kerr facebook profile
Harry Kerr
From Glasgow, United Kingdom
Harry Kerr facebook profile
Harry Kerr, harry.kerr.169
Lives in London, United Kingdom
Studied at The University of Nottingham
The University of Nottingham
Harry Kerr facebook profile
Harry Kerr, kingkerr.x
Lives in Geelong, Victoria
Studies Bachelor of Commerce at Deakin University
Deakin University
Harry Kerr facebook profile
Harry Kerr, harry.kerr.94
Lives in Lancaster, California
Lancaster, California
Harry Kerr facebook profile
Harry Kerr, harry.kerr.188
Lives in Penrith, Cumbria
Penrith, Cumbria
Harry Kerr facebook profile
Harry Kerr, harry.kerr.167
Lives in Gold Coast, Queensland
Studies at Griffith University
Coach at Gecko Sports
Harry Kerr facebook profile
Harry Kerr, harry.kerr.161
Worked at Selfridges
Studied at University of Arkansas
University of Arkansas
Harry Kerr facebook profile
Harry Kerr, Harry-Kerr
Lives in Upper Hutt, New Zealand
Upper Hutt, New Zealand
Harry Kerr facebook profile
Harry Kerr, hazza.kerr
Lives in Los Angeles, California
Goes to Canberra High School
Canberra High School
Harry Kerr facebook profile
Harry Kerr, harry.kerr.988
Lives in Caledon, Armagh, United Kingdom
Self-employed
Caledon, Armagh, United Kingdom
Harry Kerr facebook profile
Harry Kerr, Harry-Kerr
Lives in Oxnard, California
Went to Vista Real Charter High School '10
Works at Ventura County Rescue Mission
Harry Kerr facebook profile
Harry Kerr
Lives in Ballymoney
Went to Coleraine Academical Institution
Coleraine Academical Institution
Harry Kerr facebook profile
Harry Kerr, HarryK123
Lives in Newcastle, New South Wales
Studied at Warners Bay High School
Warners Bay High School
Harry Kerr facebook profile
Harry Kerr
From Melbourne, Victoria, Australia
Harry Kerr facebook profile
Harry Kerr, harry.kerr.5
Lives in Palmerston North, New Zealand
Studies at Massey University '18
Massey University
Harry Kerr facebook profile
Harry Kerr, harry.kerr.714
Went to Beccles free school
Beccles free school
Harry Kerr facebook profile
Harry Kerr
Lives in Saddle River, New Jersey
Went to Saddle River Day School '11
Saddle River Day School
Harry Kerr facebook profile
Harry Kerr, harry.kerr.589
Lives in Sussex, New Brunswick
Worked at IT Security Consultant
Sussex, New Brunswick
Harry Kerr (Harry) facebook profile
Harry Kerr (Harry)
Lives in Bangor, County Down
Bangor, County Down
Harry Kerr facebook profile
Harry Kerr, harry.kerr.777
Lives in Massena, New York
Studied at Norwood - Norfolk Central School
odd jobs at Work odd jobs
Harry Kerr facebook profile
Harry Kerr, harry.kerr.5030
Lives in George Town, Cayman Islands
Works at Pro Painter
Harry Kerr (Harry Kerr) facebook profile
Harry Kerr (Harry Kerr), pthanhduy
Lives in Hanoi, Vietnam
Studied at Đại Học Sân Khấu - Điện Ảnh Hà Nội
Đại Học Sân Khấu - Điện Ảnh Hà Nội
Harry Kerr facebook profile
Harry Kerr
Lives in Ayrshire
Went to Queen Margaret Academy
h at With mentaly disturbed seagulls
Harry Kerr facebook profile
Harry Kerr, harry.kerr.378
Lives in Nottingham, United Kingdom
Studied at Nottingham High School for Boys '15
Nottingham High School for Boys
Harry Kerr facebook profile
Harry Kerr, harrykerr100
Lives in Edinburgh, United Kingdom
Studied HND Business at West Lothian College '96
Sales & Business Development Manager at Bank of Scotland
Harry Kerr facebook profile
Harry Kerr, harry.kerr.108
Lives in Chippenham, Wiltshire
Chippenham, Wiltshire
Harry Kerr facebook profile
Harry Kerr
Lives in New York, New York
New York, New York
Harry Kerr facebook profile
Harry Kerr, harry.kerr.5815
Lives in North Little Rock, Arkansas
Studied at University of Arkansas at Little Rock
Works at Central Flying Service, Inc.
Harry Kerr facebook profile
Harry Kerr
Former Sales Assistant at John Lewis
Studies Chemistry at University of Leeds
University of Leeds
Harry Kerr facebook profile
Harry Kerr, harry.kerr.129
Worked at John Kerr
Studied at Life Baby
Life Baby
Harry Kerr facebook profile
Harry Kerr, harrison.kerr.104
Self-employed
Studied Public Services Level 3 at City College Norwich
Plumber at Verwin Plumbing and Heating
Harry Kerr facebook profile
Harry Kerr, harry.kerr.982
Self Employed (Business)
Studied at Glasgow School of Art '85
Works at Self Employed (Business)
Harry Kerr facebook profile
Harry Kerr, harry.kerr.9
Lives in Oswestry
Went to The Marches School '06
The Marches School

Harry Kerr LinkedIn Profiles

Harry Ali'i T. Kerr Jr. linkedin profile
Harry Ali'i T. Kerr Jr.
Real Estate Investor/Wholesaler/Rehabber/Landlord
Real Estate
Salt Lake City, Utah
Harry Kerr linkedin profile
Harry Kerr
Human Resources
Lynchburg, Virginia Area
Harry Kerr linkedin profile
Harry Kerr
lawenforcement Retired at Retired and enjoying Life.
Religious Institutions
Clarkston, Washington
Harry Kerr linkedin profile
Harry Kerr
United States
Harry R Kerr Jr linkedin profile
Harry R Kerr Jr
United States
Harry Kerr linkedin profile
Harry Kerr
Correctional Officer at State of Connecticut
Law Enforcement
Hartford, Connecticut Area
Harry Kerr linkedin profile
Harry Kerr
United States
Kerr Harry linkedin profile
Kerr Harry
Coordinator at Rochester Community and Technical College
Education Management
Rochester, Minnesota

Harry Kerr addresses, contacts, age, possible relatives

Name
Born in
Address
Contacts
Possible Relatives
Harry Kerr
470 165th St,New York, NY 10032

Former addresses
26208 149th Rd, Jamaica, NY 11422
434 163rd St #21, New York, NY 10032
(718) 712-7333
Harry A Kerr
Born in 1940
13144 Williams Rd,Gulfport, MS 39503

Former addresses
RR 6, Biloxi, MS 39540
14142 Lorraine Rd #47, Biloxi, MS 39532
590H PO Box, Biloxi, MS 39533
(228) 832-9409

Former phone numbers
(601) 832-9409


Possible e-mails
jjlovescats@cableone.net
Jimmie M Kerr
Harry Conway Kerr
Born in 1950
5436 Hatteras Rd,Virginia Beach, VA 23462

Former addresses
5529 Princess Anne Rd, Virginia Beach, VA 23462
4814 Woods Edge Rd, Virginia Beach, VA 23462
(757) 497-8202
Harry Kerr
Born in 1935
2460 Grant Hill Rd #RR,Waterville, NY 13480

Former addresses
RR 1, Waterville, NY 13480
123 RR 1 POB, Waterville, NY 13480
1 RR 1 #123, Waterville, NY 13480
Hamover, Waterville, NY 13480
(315) 841-4758

Former phone numbers
(315) 841-8715
Harry T Kerr
Born in 1914
6247 Duncan Dr,Youngstown, OH 44514

Former addresses
6247 Duncan Dr, Poland, OH 44514
51 Duncan Dr, Youngstown, OH 44514
1668 Wakefield, You, OH 00000
(330) 757-2928
Harry B Kerr
Born in 1926
7349 Ulmerton Rd #261,Largo, FL 33771

Former addresses
7349 Ulmerton Rd #164, Largo, FL 33771
7349 Ulmerton Rd #228, Largo, FL 33771
7349 Ulmerton Rd, Largo, FL 33771
4399 Pima St #6, Tucson, AZ 85712
(727) 524-1792

Former phone numbers
(727) 524-1792
(520) 326-3617
(727) 535-1126
Harry D Kerr
Born in 1923
126 Hancock St,Abington, MA 02351

Former addresses
2206 PO Box, Abington, MA 02351
275 Ashland St, Abington, MA 02351
(508) 586-3105

Former phone numbers
(617) 878-5185
Kathryn E Kerrdriscoll
Edith A Kerr
Ea Kerr
Harry Kerr
1104 Raguet St #A,Lufkin, TX 75904

Former addresses
1717 Copeland St, Lufkin, TX 75904
(936) 632-3359

Former phone numbers
(936) 632-3359
(936) 639-1816
(936) 639-1816
Harry Lee Kerr
Born in 1940
Graham Rd,Mount Ulla, NC 28125

Former addresses
1290 Hall Rd, Mount Ulla, NC 28125
RR 1 APALCH, Mount Ulla, NC 28125
Hall Rd, Mount Ulla, NC 28125
53 RR 2, Mount Ulla, NC 28125
53 RR 2 POB, Mount Ulla, NC 28125
2440 Graham Rd, Mount Ulla, NC 28125
53 RR 1 POB, Mount Ulla, NC 28125
520 Hall Rd, Mount Ulla, NC 28125
241 RR 1 POB, Mount Ulla, NC 28125
550 Hall Rd, Mount Ulla, NC 28125
(704) 278-2870

Former phone numbers
(281) 259-9665
(704) 278-2870
(704) 699-8241
Gail A Kerr
Grey Coolidge Kerr
Evelyn L Kerr
Ginger Gail Kerr
Cathy G Kerr
Harry M Kerr
143 Estes Rd,Cave City, KY 42127
Harry W Kerr
Born in 1914
280 Brownstown Rd,Irwin, PA 15642

Former addresses
280 Brownstown Rd, North Huntingdon, PA 15642
280 Browntown Rd, Irwin, PA 15642
(724) 863-9635
Vivien G Kerr
Susan Kerr
Harry L Kerr
Born in 1967
3702 Chaffee Dr,Fort Smith, AR 72904

Former addresses
967 PO Box, Alma, AR 72921
1319 Dallas St #2, Fort Smith, AR 72901
88A PO Box, Waldron, AR 72958
1421 Dallas St #16, Fort Smith, AR 72901
4515 Kinkead Ave #2, Fort Smith, AR 72903
(479) 784-5012

Former phone numbers
(501) 783-4451
Harry Newton Kerr
Born in 1960
6923 Fm 1488 Rd,Magnolia, TX 77354

Former addresses
13923 Hunters Ct, Montgomery, TX 77356
26 Crestone Pl #77381, The Woodlands, TX 77381
14371 Fm 1097 Rd, Willis, TX 77378
1342 Martin St, Houston, TX 77018
39 Cottage Grove Pl, Spring, TX 77381
7419 Fm 1488 Rd, Magnolia, TX 77354
1802 Wellman, Spring, TX 77381
25700 I H #1, Spring, TX 77386
1802 Wellman Rd, Conroe, TX 77384
1802 Wellman, Spring, TX 77373
25700 Interstate 45, Spring, TX 77386
39 Cottage Grove Pl, The Woodlands, TX 77381
25522 McDonald Rd, Spring, TX 77380
10720 Timber, Spring, TX 77388
10720 Timberwagon Cir, Spring, TX 77380
(936) 449-4040

Former phone numbers
(281) 367-9840
(713) 682-2721
(281) 298-6740
(936) 449-4040
(713) 367-9840
Rendyrae Kerr
Kathryn Yvonne Kerr
Katheyn Kerr
Rendy B Kerr

Associated names
H Kerr
Harry Harmon Kerr
Born in 1925
10 Violet Ct,North Little Rock, AR 72116

Former addresses
8618 Northgate Dr, North Little Rock, AR 72120
10 Violet Ct, N Little Rock, AR 72116
8618 Northgate Dr, Sherwood, AR 72120
2105 Middleton Dr, North Little Rock, AR 72116
(501) 834-5642

Former phone numbers
(501) 753-3587
(501) 834-5642
(501) 753-3587
Doris Jean Kerr
Carmel Kathleen Kerr
Jean Kerr
Jean Kerr
Doris J Kerr
Jr Harryh Kerr
Jean Kerr
Doris J Kerr
Iii Harryh Kerr

Associated names
Harry H Iii Kerr, Harry H Kerr Jr, Harry H Kerr, Harry H Kerr, Harry H Jr Kerr, Harry Harmon Kerr
Harry P Kerr
Born in 1919
1621 Route 9,Ocean View, NJ 08230

Former addresses
183 PO Box, Ocean View, NJ 08230
183 Po #183, Ocean View, NJ 08230
34 Red Berry Rd, Levittown, PA 19056
1621 Shore, Ocean View, NJ 08230
(609) 390-1171

Former phone numbers
(215) 943-3454
Ill Kerr
Harvy Kerr
Judy Kerrcerra
Florence L Kerr
Charles A Kerr
Betty M Kerr
James E Kerriii
Harry Kerr
Born in 1934
34 County Road 435,Killen, AL 35645

Former addresses
Briggs, Killen, AL 35645
Briggs Ln, Killen, AL 35645
518 RR 1 #518, Killen, AL 35645
RR 1 DIXIE TRAILERCTE, Killen, AL 35645
34 County Road 407, Killen, AL 35645
189 County Road 434, Killen, AL 35645
518 PO Box, Killen, AL 35645
(256) 757-1767

Former phone numbers
(256) 757-1767
(256) 436-0890
Shelia W Kerr
Sheila W Kerr
Harry C Kerr
Born in 1929
6019 Green Falls Dr,Houston, TX 77088

Former addresses
1121 24th St, Houston, TX 77009
(281) 999-0100

Former phone numbers
(713) 869-2743
Harry P Kerr
Born in 1946
221 New York Ave,Villas, NJ 08251

Former addresses
1101 Highland Ave #2, Cinnaminson, NJ 08077
120 Florida Ave, Villas, NJ 08251
660 PO Box, Mount Joy, PA 17552
221 New York Ave, Villas, NJ 08251
712 Heritage Rd, Cinnaminson, NJ 08077
6805 Roosevelt Blvd, Philadelphia, PA 19149
240 Woodlands Dr, Tuxedo Park, NY 10987
712 Heritage, Philadelphia, PA 19149
515 PO Box, Mount Freedom, NJ 07970
(856) 303-9779

Former phone numbers
(215) 743-3554
(856) 786-0328
Harry P Kerrsr
John W Kerr
Jr H Kerr
Louise Phw Kerr
Denise M Kerr
Sophia L Kerr
Katherine Kerr
John W Kerr
Christopher G Kerr

Associated names
Harry P Kerr, Harry P Kerr
Harry C Kerr
Born in 1942
1592 Bonner Rd,Oak Grove, LA 71263

Former addresses
514 McHue Rd, Batesville, AR 72501
908 Hill St, Newark, AR 72562
62 PO Box, Newark, AR 72562
General Delivery, Newark, AR 72562
(318) 428-2401

Former phone numbers
(870) 799-3417
(318) 428-2401
Vonnie Kerr
Lavaughn C Kerr
Lav Kerr
Elisa K Turner
Elsie K Kerr
Harry K Kerr
Born in 1964
3083 Fort Socrum Village Blvd,Lakeland, FL 33810

Former addresses
1140 PO Box, White Plains, NY 10602
22224 143rd Ave #2, Jamaica, NY 11413
5099 Society Pl #A, West Palm Beach, FL 33415
82 Prospect Ave, White Plains, NY 10607
2828 Tennis Club Dr, West Palm Beach, FL 33417
5099 Society Pl #8A, West Palm Beach, FL 33415
15 Dobbs Ferry Rd #2, White Plains, NY 10607
12801 PO Box, New York, NY 10249
4388 Weymouth St, Lake Worth, FL 33461
(863) 614-1650

Former phone numbers
(561) 478-3674
(914) 997-8104
(914) 682-3562
Claudia R Kerr
Valerie G Kerr
Percival Kerr
Jennifer M Kerr
Daniel Kerr
Barrington O Kerr
Joan M Kerr
Claudia R Kerr
Donovan L Kerr
Harry Kerr
Born in 1913
3 Park Ln,Mount Vernon, NY 10552
(914) 664-6577
Caroline M Kerr
C Kerr
Harry Bruff Kerr
Born in 1917
1911 Carroll St #3,Houston, TX 77030

Former addresses
520 Atascocita Rd #D17, Humble, TX 77396
(713) 795-5303
Harry Dean Kerr
Born in 1958
40612 161st St,Lancaster, CA 93535

Former addresses
505 Avenue J4, Lancaster, CA 93534
Indian Cove Rd, Twentynine Palms, CA 92277
40612 16uth, Lancaster, CA 93551
16249 Nordhoff St, North Hills, CA 91343
40612 16th St, Palmdale, CA 93551
9735 Swinton Ave, Sepulveda, CA 91343
(661) 264-2093

Former phone numbers
(805) 264-2093
Loreen Elizabeth Kerr
Beth I Kerr

Associated names
Dean H Kerr
Harry Kerr
11200 102nd Ave #97,Seminole, FL 33778
Harry P Kerr
93 Phyllis Ave,Buffalo, NY 14215
(716) 834-8496
Viola Kerr

Harry Kerr Addresses, Phone Numbers

Name
Address
County
Phone
Harry Kerr
1421 DALLAS ST, FORT SMITH, AR, 72901
SEBASTIAN
(479) 784-5012
Harry Kerr
8618 NORTHGATE DR, SHERWOOD, AR, 72120
PULASKI
(501) 834-5642
Harry Kerr
34 COUNTY ROAD 435, KILLEN, AL, 35645
LAUDERDALE
(256) 757-1767
Harry Kerr
2176 30TH AVE, VERO BEACH, FL, 32960
INDIAN RIVER
(772) 567-8124
Harry Kerr
40612 161ST ST E, LANCASTER, CA, 93535
LOS ANGELES
(661) 264-2093
Harry Kerr
7706 SAINT JOHNS RD, LAND O LAKES, FL, 34638
PASCO
(813) 996-2204
Harry Kerr
24 ELAINE DR, SEYMOUR, CT, 6483
NEW HAVEN
(203) 888-5113
Harry Kerr
509 CALLE DE SOTO, SAN CLEMENTE, CA, 92672
ORANGE
(949) 361-5706
Harry Kerr
1421 DALLAS ST, FORT SMITH, AR, 72901
SEBASTIAN
(479) 784-5012
Harry Kerr
34 COUNTY ROAD 435, KILLEN, AL, 35645
LAUDERDALE
(256) 757-1767
Harry Kerr
40612 161ST ST E, LANCASTER, CA, 93535
LOS ANGELES
(661) 264-2093
Harry Kerr
1624 FRESNO ST APT 26, FORT SMITH, AR, 72901
SEBASTIAN
(479) 434-2243
Harry Kerr
8618 NORTHGATE DR, SHERWOOD, AR, 72120
PULASKI
(501) 834-5642
Harry Kerr
10 VIOLET CT, NORTH LITTLE ROCK, AR, 72116
PULASKI
(501) 753-3587
Harry Kerr
7706 SAINT JOHNS RD, LAND O LAKES, FL, 34638
PASCO
(813) 996-2204
Harry Kerr
10 VIOLET CT, NORTH LITTLE ROCK, AR, 72116
PULASKI
(501) 753-3587
Harry Kerr
7349 ULMERTON RD LOT 261, LARGO, FL, 33771
PINELLAS
(727) 524-1792
Harry Kerr
46 CLIPPER CT, BEAR, DE, 19701
NEW CASTLE
Harry Kerr
221 TOWERVIEW DR E, HAINES CITY, FL, 33844
POLK
(863) 419-2681
Harry Kerr
11722 DAWN ST, EAGLE RIVER, AK, 99577
ANCHORAGE
(907) 694-2726
Harry Kerr
3083 FORT SOCRUM VILLAGE BLVD, LAKELAND, FL, 33810
POLK
Harry Kerr
4388 WEYMOUTH ST, LAKE WORTH, FL, 33461
PALM BEACH
(561) 969-0236
Harry Kerr
3511 VIA MARINA AVE, OXNARD, CA, 93035
VENTURA
(805) 985-5515
Harry Kerr
509 CALLE DE SOTO, SAN CLEMENTE, CA, 92672
ORANGE
(949) 492-3814
Harry Kerr
11722 DAWN ST, EAGLE RIVER, AK, 99577
ANCHORAGE
(907) 694-2726

Harry Kerr's Real Estate

Name
Owner Address
Real Estate Address
Value
Year of construction
KERR, HARRY P SR & LOUISE P
221 W NEW YORK AVE, VILLAS, NJ, 08251
Real Estate Address
221 W NEW YORK AVENUE, NJ
Value $168,000
KERR HARRY + CAROLINE JEAN
1792 HEATHER HEIGHTS DR, CRESCENT, PA 15046
Real Estate Address
1416 NE 2ND AVE, CAPE CORAL, FL 33909
KERR, HARRY P SR & LOUISE P
221 W NEW YORK AVE, VILLAS, NJ, 08251
Real Estate Address
120 E FLORIDA AVENUE, NJ
Value $185,800
Year of construction 1932
KERR, HARRY P JR
240 WOODLANDS DR, TUXEDO, NY, 10987
Real Estate Address
21 CHEYENNE RD, NJ
Value $88,400
Year of construction 1982
KERR HARRY W & DORIS F
7706 SAINT JOHNS RD, LAND O LAKES, FL 34638
Real Estate Address
7716 ST JOHNS RD, LAND O LAKES, FL 34638
Year of construction 1972
KERR HARRY A
4388 WEYMOUTH ST, LAKE WORTH, FL 33461
Real Estate Address
4388 WEYMOUTH ST, LAKE WORTH, FL 33461
Value $73,230
Year of construction 1996
KERR HARRY
221 TOWERVIEW DR E, HAINES CITY, FL 33844
Real Estate Address
221 TOWER VIEW DR E, HAINES CITY, FL 33844
Year of construction 2006
KERR HARRY W & DORIS F
7706 SAINT JOHNS RD, LAND O LAKES, FL 34638
Real Estate Address
7706 ST JOHNS RD, LAND O LAKES, FL 34638
Value $37,077
Year of construction 1984
KERR, HARRY P & LOUISE P
1101 HIGHLAND AVE, CINNAMINSON, NJ, 080772210
Real Estate Address
1101 HIGHLAND AVE, CINNAMINSON, NJ, 080772210
Value $262,800
Year of construction 1925
KERR HARRY + CAROLINE JEAN
1792 HEATHER HEIGHTS DR, CRESCENT, PA 15046
Real Estate Address
1412 NE 2ND AVE, CAPE CORAL, FL 33909
KERRIGAN HARRY R & KYOKO
Real Estate Address
760 VACCINUM WAY, OSTEEN, FL 32764
Value $127,493
Year of construction 2006

Harry Kerr in Car Registration Database

Name
Address
Phone
Car Model
VIN
Harry Kerr
14371 E FM 1097 RD, WILLIS, TX 77378-4357
(936) 449-4040
Car Model 2008 PORSCHE CAYENNE
VIN WP1AA29P28LA28758
Harry Kerr
12807 Keswick Ln, Bowie, MD 20715-2845
Car Model 2007 BUICK LUCERNE
VIN 1G4HD572X7U232793
Harry Kerr
6923 Fm 1488 Rd, Magnolia, TX 77354-1436
(936) 449-4040
Car Model 2012 JEEP WRANGLER UNLIMITED
VIN 1C4BJWEG3CL253363
Harry Kerr
6923 Fm 1488 Rd, Magnolia, TX 77354-1436
(936) 449-4040
Car Model 2012 FORD F-150
VIN 1FTFW1EFXCFC55820
Harry Kerr
RR 4 Box 565, Eufaula, OK 74432-9427
(918) 618-4255
Car Model 2007 CHEVROLET TRAILBLAZER
VIN 1GNDS13S972245819
Harry Kerr
40612 161st St E, Lancaster, CA 93535-7304
(661) 264-2093
Car Model 2010 HONDA ODYSSEY
VIN 5FNRL3H7XAB104547
Harry Kerr
3317 WESTON CT SW, ROCHESTER, MN 55902-1310
Car Model 2007 KARA BS17
VIN 5KTBS17127F202752
Harry Kerr
24 Elaine Dr, Seymour, CT 06483-2309
(203) 888-5113
Car Model 2007 BUICK LUCERNE
VIN 1G4HR57Y37U143329
Harry Kerr
14371 E FM 1097 RD, WILLIS, TX 77378-4357
Car Model 2007 DODGE RAM 3500
VIN 3D7MX49C47G713027
Harry Kerr
104 Chameleon Ct, Owens Cross Roads, AL 35763-5504
(256) 757-1767
Car Model 2011 FORD ESCAPE
VIN 1FMCU0D71BKA25419
Harry Kerr
14371 E FM 1097 RD, WILLIS, TX 77378-4357
(936) 449-4040
Car Model 2008 FORD F350
VIN 1FTWW31R28EE46883
Harry Kerr
1835 HILLYARD DR, CLARKSTON, WA 99403-3033
Car Model 2009 CHRYSLER PT CRUISER
VIN 3A8FY589X9T601752

Harry Kerr Marketing Data

Name, Address, Phone
Marketing Data
Mr. Harry Kerr
1421 Dallas St Fort Smith AR 72901 APT 3-6365
Income - estimated household: Under $10,000
Range of new credit: Greater than $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Harry Kerr
1528 Pensacola St Honolulu HI 96822 APT 4-3838
(808) 523-1864
igor@ihateclowns.com
Income - estimated household: $100,000 - $149,999
Estimated net worth: $50,000 - $99,999
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Harry P Kerr
221 W New York Ave Villas NJ 08251-2572 -3105
(609) 770-7447
Home owner source: Verified Home Owner
Income - estimated household: $35,000 - $39,999
Estimated net worth: $50,000 - $99,999
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Harry Kerr
1104 S Raguet St Lufkin TX 75904 -4004
(936) 632-3359
Home owner source: Verified Home Owner
Income - estimated household: $25,000 - $29,999
Estimated net worth: $1 - $4,999
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Harry Kerr
104 Chameleon Ct Owens Cross Roads AL 35763 -5504
(256) 536-6706
Home owner source: Verified Home Owner
Income - estimated household: $15,000 - $19,999
Estimated net worth: $250,000 - $499,999
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Harry R Kerr
695 Burdett Dr Aston PA 19014 -2505
(610) 485-7546
Home owner source: Verified Home Owner
Income - estimated household: $65,000 - $74,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 2 Lines
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Harry W Kerr
1273 E Ferry Rd Gladys VA 24554 -2657
(434) 332-5469
Home owner source: Verified Home Owner
Income - estimated household: $10,000 - $14,999
Estimated net worth: $50,000 - $99,999
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Harry R Kerr
1835 Hillyard Dr Clarkston WA 99403 -3033
(907) 694-2726
Home owner source: Verified Home Owner
Income - estimated household: $25,000 - $29,999
Estimated net worth: $10,000 - $24,999
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Harry W Kerr
7706 Saint Johns Rd Land O Lakes FL 34638 -2510
(813) 996-2204
hkerr@charter.net
Home owner source: Verified Home Owner
Income - estimated household: $35,000 - $39,999
Estimated net worth: $100,000 - $249,999
Range of new credit: Greater than $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Harry B Kerr
4357 Keewahdin Rd Fort Gratiot MI 48059 -3208
(810) 434-6901
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Harry A Kerr
139 Jensen Ave Mamaroneck NY 10543 -2928
(718) 824-0512
crazyjumpin@twcny.rr.com
Home owner source: Verified Home Owner
Income - estimated household: $100,000 - $149,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 4 Lines
Range of new credit: $5,001 - $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Harry A Kerr
1735 N Warren Ave Oklahoma City OK 73107 -3653
(405) 943-0152
mwolfpacx88@aol.com
Home owner source: Verified Home Owner
Income - estimated household: $40,000 - $44,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 2 Lines
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Harry Kerr
4307 Rosebelle Ave Killeen TX 76549 -2792
(254) 554-7035
hlkerr@earthlink.net
Home owner source: Verified Home Owner
Income - estimated household: $15,000 - $19,999
Estimated net worth: $50,000 - $99,999
Range of new credit: $5,001 - $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Harry D Kerr
40612 161st St E Lancaster CA 93535 -7304
(661) 264-2093
loreenkerr@aol.com
Home owner source: Verified Home Owner
Income - estimated household: $30,000 - $34,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Harry C Kerr
24 Elaine Dr Seymour CT 06483 -2309
(203) 888-5113
hkerr1883@att.net
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 2 Lines
Range of new credit: Greater than $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Harry A Kerr
4388 Weymouth St Lake Worth FL 33461 -2748
(561) 969-0236
claudiarkerr@gmail.com
Home owner source: Verified Home Owner
Income - estimated household: $40,000 - $44,999
Estimated net worth: $25,000 - $49,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $501 - $1,000
Education: Completed High School
Ethnic group: All African American Ethnic Groups
Mr. Harry I Kerr
2536 Robinwood Dr Lafayette IN 47909 -2340
(765) 474-2852
bryskerr@yahoo.com
Home owner source: Verified Home Owner
Income - estimated household: $25,000 - $29,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $501 - $1,000
Education: Completed High School
Ethnic group: Western European
Mr. Harry Kerr
4025 Morgans Point Rd Belton TX 76513 -6826
(254) 780-1568
reeses76513@aol.com
Home owner source: Verified Home Owner
Income - estimated household: $55,000 - $59,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $5,001 - $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Harry Z Kerr
5342 S 3375 W Roy UT 84067 -9283
(801) 775-8415
destiny8510@msn.com
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 2 Lines
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European

Harry Kerr Whois Records

Domain
Registrar Data
avaloninvestment.com
hkerr@avaloninvestment.com
Whois sever: whois.tucows.com
Create / update date: 12-sep-2001 / 13-aug-2013
TUCOWS DOMAINS INC.
2 Market Place Tetbury gloucestershire GL8 8DA, UNITED KINGDOM
441666501710
donegalfilm.com
memoryfactory@eircom.net
Whois sever: whois.123-reg.co.uk
Create / update date: 25-jun-2007 / 25-jun-2012
WEBFUSION LTD.
Old Surgery|Castle Avenue Buncrana County Donegal 077, IRELAND
4435374320808
donegalphotographers.com
memoryfactory@eircom.net
Whois sever: whois.123-reg.co.uk
Create / update date: 19-apr-2007 / 18-apr-2013
WEBFUSION LTD.
Old Surgery|Castle Avenue Buncrana County Donegal 077, IRELAND
4435374320808
donegalphotography.com
memoryfactory@eircom.net
Whois sever: whois.123-reg.co.uk
Create / update date: 19-apr-2007 / 18-apr-2013
WEBFUSION LTD.
Old Surgery|Castle Avenue Buncrana County Donegal 077, IRELAND
4435374320808
kerr05.com
hwkerr@gmail.com
Whois sever: whois.meshdigital.com
Create / update date: 13-oct-2012 / 13-oct-2012
MESH DIGITAL LIMITED
5 Beechfield Crescent BANGOR BT19 7ZJ, UNITED KINGDOM
442891452427
marketplacefinancialservices.com
hkerr@avaloninvestment.com
Whois sever: whois.tucows.com
Create / update date: 20-mar-2007 / 21-mar-2013
TUCOWS DOMAINS INC.
2 Market Place Tetbury Gloucestershire GL8 8DA, UK
0441666501710
memoryfactoryphoto.com
harrykerr@mac.com
Whois sever: whois.123-reg.co.uk
Create / update date: 09-oct-2002 / 16-aug-2011
WEBFUSION LTD.
36 Lisowen Avenue|Buncrana Lifford County Donegal 077, IRELAND
003537720808
memoryfactorystudio.com
memoryfactory@eircom.net
Whois sever: whois.123-reg.co.uk
Create / update date: 09-oct-2002 / 16-aug-2011
WEBFUSION LTD.
36 Lisowen Avenue|Buncrana Lifford County Donegal 077, IRELAND
003537720808

Donations from Harry Kerr

Name
Address
Occupation
Amount
Recipient
Harry Kerr
695 BURDETT DR ASTON PA 19014
Occupation
Amount $200.00
Recipient BARRAR, STEPHEN E
Harry Kerr
4641 N ARDMORE AVE WHITEFISH BAY WI 53211
Occupation
Amount $100.00
Recipient WASSERMAN, SHELDON A
Harry Kerr
2460 GRANT HILL RD WATERVILLE NY 13480
Occupation PLUMBER, SELF-EMPLOYED
Amount $500.00
Recipient Rick Santorum (R)

Harry Kerr in US Voter Database

Name
Address
Phone
E-mail
Party
Harry Kerr
12807 KESWICK LN, BOWIE, MD, 20715
(301) 706-0621
hkerr@erols.com
Independent
Harry Kerr
4357 KEEWAHDIN RD, FORT GRATIOT, MI, 48059
(810) 434-6901
harry.kerr@att.net
Independent
Harry Kerr
5 KIERNAN WAY, TRENTON, NJ, 8690
(609) 977-1413
harry.kerr@comcast.net
Independent
Harry Kerr
5342 S 3375 W, ROY, UT, 84067
(801) 726-2873
harry.kerr@msn.com
Harry Kerr
(408) 661-5576
harry.kerr@comcast.net
Republican
Harry Kerr
4641 N ARDMORE AVE, MILWAUKEE, WI, 53211
(414) 550-8461
harry.kerr@earthlink.net
Democrat
Harry Kerr
7706 SAINT JOHNS RD, LAND O LAKES, FL, 34638
(813) 503-5780
hkerr@charter.net
Harry Kerr
(479) 784-5012
hkerr@juno.com
Republican


People Finder Catalog

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z 


0.024 s.