Darren Prince - we found 145 people search records: 64 CVs and social profiles with photos, 39 addresses & phone numbers, 7 Darren Prince's cars, 3 companies. You can specify the type of records and the US state:
Darren Prince Admissions Director/Owner at Ashcreek Ranch Academy Mental Health Care Toquerville, Utah
Darren Prince Project Manager Construction Overland Park, Kansas
DARREN PRINCE United States
Darren Prince United States
Darren Prince Renewables & Environment Orange County, California Area
Darren Prince United States
Darren Prince Project Manager at OMNI Energy Services Oil & Energy Taylorsville, Mississippi
Darren Prince Manufacturing Associate Information Technology and Services Dunn, North Carolina
Darren W. Prince Account Executive at CIBC World Markets Investment Banking Toronto, Canada Area
55 Darren Prince's Social Profiles
Darren Prince Facebook: darren.prince.180 Lives in Ashford, Kent Studied at Towers School & Sixth Form '01 Towers School & Sixth Form
Darren Prince Facebook: darren.prince.71 Lives in Emerald, Queensland Went to Moura State High School Moura State High School
Darren Prince Facebook: darrensammy.darrensammy Lives in Lahore, Pakistan Student Studying at Student
Darren Prince Went to Winston Churchill School Winston Churchill School
Darren Prince Facebook: Darren-Prince Lives in Bolton Went to Sharples High School Sharples High School
Darren Prince Facebook: dl.liclican From Southern Davao, Davao, Philippines Owner at wOrK aT sA pUsO nG pAmIlYa kO!!studied at university of dulangan national high school.
Darren Prince Facebook: darren.prince.58 Lives in Leeds, Kent Leeds, Kent
Darren Prince Facebook: darren.prince.5661 Lives in Manchester, United Kingdom Manchester, United Kingdom
Darren Prince Facebook: Darren-Prince From General Santos City Studied at Ateneo de Manila University Ateneo de Manila University
Darren Prince Facebook: darren.prince.773 From Derby, Connecticut
Darren Prince Lives in Wallsend Business Owner at DP Mobile Valeting
Darren Prince Facebook: darren.prince.946 self employed at my house<3 Studied Business management at University of Miami Owner at self employed at my house<3
Darren Prince Lives in Victoria, British Columbia Studied Software engineering at University of Victoria Software Engineer at Tutela Technologies
Darren Prince Lives in Toquerville, Utah Toquerville, Utah
Darren Prince Facebook: darren.prince.714 Lives in Pretoria, South Africa Went to EDUcare College EDUcare College
Darren Prince Facebook: Darren-Prince Lives in Burnley, Lancashire Burnley, Lancashire
Darren Prince Facebook: darren.prince.9216 Lives in New York, New York Went to Merrick Academy Cashier at Burberry Prorsum
Darren Prince Facebook: darren.prince.37 Self-employed Went to John Marshall High School '85 John Marshall High School
Darren Prince Facebook: darren.prince.50 Went to Lake Side Secondary School Works at Super Amart
Darren Prince Facebook: darren.prince.547 From Vieux Fort
Darren Prince Facebook: darren.prince.988 Lives in Vancouver, British Columbia Vancouver, British Columbia
Darren Prince Facebook: darren.prince.142 Lives in Pass Christian, Mississippi Went to Pass Christian High School Pass Christian High School
Darren Prince (DK Rahne) Lives in Birmingham, United Kingdom Went to Wheelers Lane Boys School '85 Wheelers Lane Boys School
Darren Prince Facebook: darren.prince.98 Lives in Powhatan, Virginia Studied at Virginia Commonwealth University Plant Manager at Luck Stone Corporation
Darren Prince Facebook: darren.prince.7509 Full Time Mommy! :) Studied at Harvard University Works at Full Time Mommy! :)
Darren Prince Facebook: darren.prince.520 Lives in Rochester, New York Studied at Kutztown University of Pennsylvania Kutztown University of Pennsylvania
Darren Prince (Dazz) From Penarth, Vale of Glamorgan
Darren Prince Facebook: darren.prince.921 Lives in Tucson, Arizona Studied at Fallsburg Junior - Senior High School Fallsburg Junior - Senior High School
Darren Prince Facebook: darren.prince.18 Former Job Coach at No where :) Went to Pass Christian High School '14 Pass Christian High School
Darren Prince Facebook: darren.prince.568 From Moree, New South Wales
Darren Prince Facebook: darren.prince.963 Works at InLove
Darren Prince Facebook: darren.t.prince Lives in Laurel, Mississippi Went to Taylorsville High School Truck driver at A&R Logistics
Darren Prince Works at SolarCity
Darren Prince Facebook: darren.prince.169 Lives in Stoke-on-Trent Studied at University of Manchester, North Manchester General Hosp. University of Manchester, North Manchester General Hosp.
Darren Prince Facebook: darren.prince.96 From Llandudno Junction Went to Ysgol Aberconwy Ysgol Aberconwy
Darren Prince Facebook: darren.prince.31 Self-employed Studied Agriculture at Reaseheath College '15 full time farmer at Self-employed
Darren Prince Lives in Bangkok, Thailand Studied at George Abbot School George Abbot School
Darren Prince Facebook: dnprince Lives in Ashford, Kent Went to Towers School & Sixth Form '01 Works at CCL Label
Darren Prince Facebook: darren.prince.52 From Bolton Studied at Turton School Turton School
Darren Prince Lives in Ballinhassig Studied at IPTAS '10 IPTAS
Darren Prince (princey) Lives in Ruskington Studied GCSE's at lafford high school '01 Truck Driver at Moy Park
Darren Prince Facebook: darren.prince.7146 Went to Uitenhage High School Uitenhage High School
Darren Prince Lives in Horwich Horwich
Darren Prince Facebook: darren.prince.12 Lives in Kettering, Northamptonshire, United Kingdom Studied at Montagu School Montagu School
Darren Prince Facebook: darren.prince.54 Lives in Livingston, New Jersey Studied Business at University of Bridgeport '89 President/CEO at Prince Marketing Group Inc.
Darren Prince Facebook: darren.prince.5688 Worked at Bored.com Studied at UNIVERSITAS TRISAKTI UNIVERSITAS TRISAKTI
Darren Prince Worked at U.S. Marine Corps
Darren Prince From Stratford, Connecticut Studied Geology and Mining at Brandeis University '08 Brandeis University
Darren Prince Facebook: darren.prince.7528 Lives in East London, Eastern Cape East London, Eastern Cape
Darren Prince Facebook: darren.prince.925 Lives in Sheffield Director at PrinceField Limited
Darren Prince Facebook: Darren-Prince Lives in New York, New York New York, New York
Darren Prince Facebook: darren.prince.338 Worked at P.T Advantage Supply Chain Management Studied Computer engineering at STIKOM Bandung STIKOM Bandung
Darren Prince Facebook: darren.w.prince Lives in Toronto, Ontario Studied Master's Degree at Richard Ivey School of Business, University of Western Ontario '06 Project Coordinator at CIBC World Markets
Darren Prince Went to Stratton Upper School Stratton Upper School
Darren Prince Facebook: darren.prince.33 Went to Hin Hua High School Hin Hua High School
16 Darren Prince's home addresses and relatives
Name
Address
Contacts
Possible Relatives
Darren M Prince
Address
6 Slopebrook Ln,Colts Neck, NJ 07722 Former addresses: 12 Stepping Rdg #L3, Fairfield, NJ 07004 802 Minogue Ter, Paramus, NJ 07652 200 Winston Dr #1610, Cliffside Park, NJ 07010 333 Lake St, Upper Saddle River, NJ 07458 128 Crain Rd, Paramus, NJ 07652 708 Galloping Hill Rd, Franklin Lakes, NJ 07417 6726 Newport Lake Cir, Boca Raton, FL 33496
Possible relatives
Claudine Renee Orlando Kalliopi C Trigazis Kalli Prince Robert Prince
Darren Prince
Address
1770 Cholla Ter,Indianapolis, IN 46240
(317) 571-9841
Darren Russell Prince
Address
7498 Route 55,Neversink, NY 12775 Former addresses: 7498 State Route 55, Neversink, NY 12765 7481 Rte #55, Grahamsville, NY 12740 625 Route 55, Neversink, NY 12765 625 PO Box, Neversink, NY 12765 9850 Camino Del Sauce, Tucson, AZ 85742 2721 Camino Llano, Tucson, AZ 85742 7481 Route 55, Neversink, NY 12765 602 PO Box, Fallsburg, NY 12733 Route #55, Neversink, NY 12765 RR 55, Neversink, NY 12765 Route 55, Neversink, NY 12765
(845) 985-2775 Former phone numbers: (914) 985-7828 (845) 985-2775
Possible relatives
Lori A Girounder Prince Lori Arlene M Prince
Darren Kevin Prince
Address
3105 Fanshawe St,Philadelphia, PA 19149 Former addresses: 0000003105 Fanshawe St, Philadelphia, PA 19149 Uss Forrestal Avt 59 Oc, Fpo Miami, FL 34080 4417 Sansom St #2F, Philadelphia, PA 19104 2601 Glenwood Rd #2D, Brooklyn, NY 11210 7200 Merion Trce #B203, Upper Darby, PA 19082 3403 Hamilton St #3R, Philadelphia, PA 19104 141 57th St, Philadelphia, PA 19139 523 42nd St #1ST-FL, Philadelphia, PA 19104 523 42nd St #1FRT, Philadelphia, PA 19104 238 Putnam Ave, Brooklyn, NY 11216 523 42nd St, Philadelphia, PA 19104 523 42nd St #1, Philadelphia, PA 19104
618 PO Box,Taylorsville, MS 39168 Former addresses: 607 RR 1 #607, Taylorsville, MS 39168 874 PO Box, Taylorsville, MS 39168 187A PO Box, Mount Olive, MS 39119 321 PO Box, Magee, MS 39111 497 PO Box, Taylorsville, MS 39168 607 PO Box, Taylorsville, MS 39168 606 PO Box, Taylorsville, MS 39168
(601) 782-4377 Former phone numbers: (601) 782-4715
2320 Cemetery Rd,Morris, IL 60450 Former addresses: 2310 Ashland Dr, Morris, IL 60450 207 Old Pne, Morris, IL 60450 223 RR 1, Broughton, IL 62817 207 Old Pine Blf #O, Morris, IL 60450 2070 Old Pine Bluff Rd, Morris, IL 60450
8916 Leeds Ct,Fredericksbrg, VA 22408 Former addresses: 4513 Bell Rd, Powhatan, VA 23139 1600 Green Tree Rd #204, Fredericksburg, VA 22406 4506 Bell Rd, Powhatan, VA 23139 6915 Carnation St #H, Richmond, VA 23225 2410 Mitchell Rd, Powhatan, VA 23139 9635 Greenmeadow Cir, Glen Allen, VA 23060 1600 Green Tree Rd #201, Fredericksburg, VA 22406 8916 Leeds Ct, Fredericksburg, VA 22408
9211 Moraine St,Dyer, IN 46311 Former addresses: 9047 Bunker Hill Dr, Munster, IN 46321 450 US Highway 30, Schererville, IN 46375 1950 Stony Is, Crete, IL 60417 1950 Stoney Island Ave, Crete, IL 60417 1950 Stoney Is, Crete, IL 60417
1752 Rustler Trl,Camp Verde, AZ 86322 Former addresses: 3865 Lake Shore Dr, Rimrock, AZ 86335 24350 Del Amo Rd, Ramona, CA 92065 2103 Westward Dr, Camp Verde, AZ 86322 2535 Verde West Dr, Camp Verde, AZ 86322 185 PO Box, La Verkin, UT 84745 4655 Cliffside Trl, Rimrock, AZ 86335 3095 Rimrock Dr, Rimrock, AZ 86335 361 280, La Verkin, UT 84745 4630 Geronimo Rd, Rimrock, AZ 86335 230 PO Box, Rimrock, AZ 86335 415 100 #1050E, Richfield, UT 84701 4620 Geronimo Rd, Rimrock, AZ 86335 3490 Old Scout Trl, Camp Verde, AZ 86322 3490 Old Scout, Camp Verde, AZ 86322 1360 Rio Verde Ln, Camp Verde, AZ 86322 450 Garden Ln, Camp Verde, AZ 86322 2115 Verde West Dr, Camp Verde, AZ 86322 425 Ioo, Richfield, UT 84701 244 State St #3, Hurricane, UT 84737 3105 Rimrock Dr, Rimrock, AZ 86335 1325 PO Box, Camp Verde, AZ 86322 1129 300, Orem, UT 84057 5224 PO Box, Lake Montezuma, AZ 86342
1207 CRESENDO DR 1207 CRESENDO DR, ROSEVILLE, CA 95678
Position Manager
Creation Date 2005-05-31
Company Status Revoked
DARREN PRINCE
Company P&P PROPERTY MANAGEMENT, LLC.
2764 LAKE SAHARA DR SUITE 111 2764 LAKE SAHARA DR SUITE 111, LAS VEGAS, NV 89117
Position Manager
Creation Date 2005-05-31
Company Status Revoked
DARREN L PRINCE
Company HOPRI ENTERPRISES LLC
330 SOUTH ASHCREEK ROAD 330 SOUTH ASHCREEK ROAD, TOQUERVILLE, UT 84729
Position Mmember
Creation Date 2011-01-19
Company Status Dissolved
Darren Prince's net worth and financial records
Name, Address, Phone
Marketing Data
Darren Prince 34541 Gladstone Pl Fremont CA 94555 -2419 (510) 847-7476
Home owner source: Highly Likely Home Owner Income - estimated household: $75,000 - $99,999 Estimated Mr. Darren A Prince net worth: $100,000 - $249,999 Lines of credit (trade counter): 1 Lines Range of new credit: $101 - $300 Education: Completed Graduate School Ethnic group: Western European
Darren Prince 7725 Hemlock St Overland Park KS 66204 -2647 (913) 314-6595 sarahprince@hotmail.com
Home owner source: Verified Home Owner Income - estimated household: $60,000 - $64,999 Estimated Mr. Darren L Prince net worth: $100,000 - $249,999 Lines of credit (trade counter): 2 Lines Range of new credit: $101 - $300 Education: Completed High School Ethnic group: Western European
Darren Prince 2962 21st St San Francisco CA 94110 -2740 (415) 824-2510
Income - estimated household: $100,000 - $149,999 Estimated Mr. Darren R Prince net worth: $1 - $4,999 Lines of credit (trade counter): 5 Lines Range of new credit: $101 - $300 Education: Completed High School Ethnic group: Western European
Darren Prince 3941 County Road 9 Estillfork AL 35745 -4530 (256) 776-6207 scoobyhunter1s@aol.com
Home owner source: Verified Home Owner Income - estimated household: $75,000 - $99,999 Estimated Mr. Darren Prince net worth: $25,000 - $49,999 Lines of credit (trade counter): 2 Lines Range of new credit: $1,001 - $3,000 Education: Completed High School Ethnic group: Western European
Darren Prince 46 Creston Ave Audubon NJ 08106 -2304 (856) 547-3005
Home owner source: Verified Home Owner Income - estimated household: $60,000 - $64,999 Estimated Mr. Darren C Prince net worth: $25,000 - $49,999 Lines of credit (trade counter): 1 Lines Range of new credit: $1,001 - $3,000 Education: Completed High School Ethnic group: Western European
Darren Prince 3105 Fanshawe St Philadelphia PA 19149 -2609 (215) 708-0323
Home owner source: Verified Home Owner Income - estimated household: $60,000 - $64,999 Estimated Mr. Darren K Prince net worth: $10,000 - $24,999 Lines of credit (trade counter): 1 Lines Range of new credit: $1,001 - $3,000 Education: Completed High School Ethnic group: Western European
Darren Prince 330 S Ashcreek Dr Toquerville UT 84774 -5028 (435) 705-5720 darren.prince@yahoo.com
Home owner source: Verified Home Owner Income - estimated household: $50,000 - $54,999 Estimated Mr. Darren L Prince net worth: $100,000 - $249,999 Lines of credit (trade counter): 1 Lines Range of new credit: $1,001 - $3,000 Education: Completed High School Ethnic group: Western European
Darren Prince 4513 Bell Rd Powhatan VA 23139 -4700 (804) 598-4880
Home owner source: Verified Home Owner Income - estimated household: $75,000 - $99,999 Estimated Mr. Darren E Prince net worth: $100,000 - $249,999 Lines of credit (trade counter): 4 Lines Range of new credit: $1,001 - $3,000 Education: Completed College Ethnic group: Western European
Darren Prince 18 Carillon Cir Livingston NJ 07039-2600 -2600 (973) 714-9409
Home owner source: Verified Home Owner Income - estimated household: $75,000 - $99,999 Estimated Mr. Darren M Prince net worth: $100,000 - $249,999 Lines of credit (trade counter): 5 Lines Range of new credit: $1,001 - $3,000 Education: Completed College Ethnic group: Western European
23 Darren Prince's websites and domain names
Domain
Registrar Data
victoriabcchimneysweep.com registered by Darren Prince darrenprince@shaw.ca Create / update date: 18-sep-2012 / 18-sep-2012
Registrar: GODADDY.COM, LLC 656 Caleb Pike Rd Victoria British Columbia v9b6g8, CANADA
dennisrodman.com registered by Darren Prince admin@princemarketinggroup.com Create / update date: 24-jul-2002 / 03-aug-2012
Registrar: GODADDY.COM, LLC 18 Carillon Circle Livingston New Jersey 07039, UNITED STATES
drodman.com registered by Darren Prince helpdesk@princemarketinggroup.com Create / update date: 10-jul-2003 / 11-may-2012
Registrar: GODADDY.COM, LLC 18 Carillon Circle Livingston New Jersey 07039, UNITED STATES
royjonesjr.com registered by Darren Prince admin@princemarketinggroup.com Create / update date: 06-mar-1997 / 24-feb-2011
Registrar: GODADDY.COM, LLC 18 Carillon Circle Livingston New Jersey 07039, UNITED STATES
hulkandfriends.com registered by Darren Prince admin@princemarketinggroup.com Create / update date: 19-jul-2010 / 11-may-2012
Registrar: GODADDY.COM, LLC 18 Carillon Circle Livingston New Jersey 07039, UNITED STATES
victoriabcchimneysweepdryerventcleaning.com registered by Darren Prince darrenprince@shaw.ca Create / update date: 25-aug-2012 / 25-aug-2012
Registrar: GODADDY.COM, LLC 656 Caleb Pike Rd Victoria British Columbia v9b6g8, CANADA
uberconsoles.com registered by Darren Prince darren.prince@me.com Create / update date: 31-mar-2009 / 01-apr-2013
Registrar: 1 & 1 INTERNET AG 36 Holmes Road Twickenham TW1 4RE, UNITED KINGDOM 442087449029
joefrazier.com registered by Darren Prince admin@princemarketinggroup.com Create / update date: 03-jul-1997 / 03-aug-2012
Registrar: GODADDY.COM, LLC 18 Carillon Circle Livingston New Jersey 07039, UNITED STATES
innerchangepostcards.com registered by Darren Prince DARRENPRINCE@ME.COM Create / update date: 12-dec-2006 / 18-oct-2013
Registrar: ENOM, INC. 3288 21ST STREET|#35 SAN FRANCISCO CA 94110, UNITED STATES
princemusicmanagement.com registered by Darren Prince admin@princemarketinggroup.com Create / update date: 23-apr-2012 / 18-apr-2013
Registrar: GODADDY.COM, LLC 18 Carillon Circle Livingston New Jersey 07039, UNITED STATES
actionreflection.com registered by Darren Prince DARRENPRINCE@ME.COM Create / update date: 16-dec-2010 / 18-oct-2013
Registrar: ENOM, INC. 3288 21ST STREET|#35 SAN FRANCISCO CA 94110, UNITED STATES
holonomix.com registered by Darren Prince darren.prince@holonomix.com Create / update date: 24-jul-2003 / 12-sep-2013
Registrar: 1 & 1 INTERNET AG Holmes Road Twickenham TW1 4RE, UNITED KINGDOM 442071901656
princerodmangroup.com registered by Darren Prince admin@princemarketinggroup.com Create / update date: 11-jun-2007 / 03-aug-2012
Registrar: GODADDY.COM, LLC 18 Carillon Circle Livingston New Jersey 07039, UNITED STATES 19733250800
princemarketinggroup.com registered by Darren Prince admin@princemarketinggroup.com Create / update date: 17-may-1999 / 03-aug-2012
Registrar: GODADDY.COM, LLC 18 Carillon Circle Livingston New Jersey 07039, UNITED STATES 19733250800
darrenprince.com registered by Darren Prince DARRENPRINCE@ME.COM Create / update date: 18-jun-2003 / 18-oct-2013
Registrar: ENOM, INC. 3288 21ST STREET|#35 SAN FRANCISCO CA 94110, UNITED STATES
holonomix.info registered by Darren Prince darren.prince@holonomix.com
Registrar: 1&1 Internet AG (R113-LRMS) Holmes Road 36 Twickenham TW1 4RE, UNITED KINGDOM 442071901656
princewedding.info registered by Darren Prince darprince@hotmail.com
Registrar: GoDaddy.com, LLC (R171-LRMS) 310 Canyon Trail Fernie British Columbia v0b 1m5, CANADA 12508123679
arthurprince.info registered by Darren Prince darren.prince@holonomix.com
Registrar: 1&1 Internet AG (R113-LRMS) Holmes Road 36 Twickenham TW1 4RE, UNITED KINGDOM 442071901656
victoriabcchimneysweep.info registered by Darren Prince darrenprince@shaw.ca
Registrar: GoDaddy.com, LLC (R171-LRMS) 656 Caleb Pike Rd Victoria British Columbia v9b6g8, CANADA 12508850336
holonomix.net registered by Darren Prince darren.prince@holonomix.com Create / update date: 17-mar-2010 / 18-mar-2013
Registrar: 1 & 1 INTERNET AG Holmes Road Twickenham TW1 4RE, UNITED KINGDOM 442071901656
uberconsoles.net registered by Darren Prince darren.prince@me.com Create / update date: 31-mar-2009 / 01-apr-2013
Registrar: 1 & 1 INTERNET AG 36 Holmes Road Twickenham TW1 4RE, UNITED KINGDOM 442087449029
aerosweep.net registered by Darren Prince darrenprince@shaw.ca Create / update date: 22-sep-2013 / 22-sep-2013
Registrar: GODADDY.COM, LLC 656 Caleb Pike Rd Victoria British Columbia v9b6g8, CANADA 2508850336
victoriachimneysweep.net registered by Darren Prince darrenprince@shaw.ca Create / update date: 27-sep-2012 / 12-sep-2013
Registrar: GODADDY.COM, LLC 656 Caleb Pike Rd Victoria British Columbia v9b6g8, CANADA 12508850336