Waylon Mills - we found 66 people search records: 7 addresses & phone numbers, 1 Waylon Mills's cars, 56 CVs and social profiles

3 Waylon Mills's phone numbers & addresses

Name
Address
County
Phone
Waylon Mills
23 PACKARD AVE, DORCHESTER CENTER, MA, 2124
SUFFOLK
Waylon Mills
2127 BROWN ST, BROOKLYN, NY, 11229
KINGS
(718) 891-0675
Waylon Mills
8860 CALUMET BLVD, PORT CHARLOTTE, FL, 33981
CHARLOTTE
(941) 697-3452

1 VINs of Waylon Mills's cars

Name
Address
Phone
Car Model
VIN
Waylon Mills
8860 Calumet Blvd, Port Charlotte, FL 33981-3358
Car Model 2011 VOLKSWAGEN JETTA
VIN 3VWPL7AJ1BM708695

4 Waylon Mills's home addresses and relatives

Name
Address
Contacts
Possible Relatives
Waylon F Mills
23 Packard,Dorchester Center, MA 02124
Possible relatives
Frank W Mills, Gloria Mills, Loren M Mills, Medina C Mills
Waylon H Mills
RR 1,Tabor City, NC 28463
Former addresses:
0 Unknown,Tabor City, NC 28463
Possible relatives
Therese Mills
Waylon F Mills
86 Hancock St #1,Dorchester, MA 02125
Former addresses:
72 Devon St, Dorchester, MA 02121
271 Midwood St #271, Brooklyn, NY 11225
9242 PO Box, Silver Spring, MD 20916
26 Malta St, Mattapan, MA 02126
600 142nd St, North Miami, FL 33161
600 142nd St #1, North Miami, FL 33161
10 Warner St, Dorchester Center, MA 02124
33 Saint Gregory St, Dorchester Center, MA 02124
(718) 531-4063
Former phone numbers:
(617) 541-3702
(718) 771-3532
(617) 282-9896
(718) 771-3532
(718) 531-4063
Possible relatives
Frank W Mills, Gloria Mills, Mediner Mills, S V Mills, Medina C Mills, Schaudinn V Bastien, Veronica Mills, Loren M Mills
Associated names
Wayylon Mills
Waylon H Mills
1701 Swamp Fox Hwy,Tabor City, NC 28463
Former addresses:
390 RR 1, Tabor City, NC 28463
205 Hickman Rd, Tabor City, NC 28463
Possible relatives
Brice Mrs Mills, Jeanette W Mills

1 CVs by Waylon Mills

Waylon Mills  Tabor City, North Carolina
Service Lead for Food Lion from Jul 2013
Started working on 2010, then the employee has changed 1 company and 1 job.

Waylon Mills's net worth and financial records

Name, Address, Phone
Marketing Data
Waylon Mills
8860 Calumet Blvd Port Charlotte FL 33981 -3358
(941) 697-9853
Home owner source: Highly Likely Home Owner
Income - estimated household: $30,000 - $34,999
Estimated Mr. Waylon Mills net worth: $100,000 - $249,999
Lines of credit (trade counter): 1 Lines
Range of new credit: Greater than $9,999
Education: Completed College
Ethnic group: Western European

55 Waylon Mills's Social Profiles

Bianca Wollen
Facebook: bianca.wollen
Former Sales Assistant at Trago Mills
Wyllian Kris
Facebook: wyllian.kris.1
Montador industrial (lider) at Mills
Studied 3"ano at Colégio Estadual Gonçalo Muniz '03
Montador Lider at Refinaria Abreu e Lima - RNEST
Michael Wallin
Facebook: michael.wallin.33
Lives in Glenville, Minnesota
Goes to Lake Mills Senior High School '18
Works at Wallin Farms
Waylon Olson
Facebook: waylon.olson.9
Lives in Longmont, Colorado
Went to KHS '04
KHS
Nicole Whelan
Facebook: nicole.whelan.73
Lives in London, United Kingdom
Studied at Royal Holloway, University of London '10
Senior Brand Manager at General Mills
Kyle Wollin
Facebook: kwollin1
Went to Lake Mills High School (WI)
Lake Mills High School (WI)
Anatasya Wulan (rawan)
Facebook: aray.jak.980
Worked at General Mills
Studied at The University of North Carolina at Chapel Hill '94
The University of North Carolina at Chapel Hill
Willian DuSax
Facebook: willian.gomes.58152
Lives in Camaçari
Studied Mathematics at Escola de 2º Grau Anselmo da Silva Santos
Montador de andaime at Mills
Kelsey Wollin
Facebook: kelsey.wollin
Lives in South Milwaukee, Wisconsin
Studied Practical Nurse / licensed at Milwaukee Area Technical College '16
Certified Nursing Assistant (CNA) at Aurora St Luke's South Shore
Sonja Wallin
Facebook: sonja.wallin.7
Studied at University of Northern Iowa
Works at Lake Mills Community School
Jodi Whalen
Facebook: jodi.whalen.9
Lives in Waterford, New York
Studied at Rochester Dental School Dental Hygiene '78
Assistant Manager of Polling center at New York State United Teachers
Waylon Mills
Facebook: waylon.mills.7
From Bush, Louisiana
Waylon Robert Mills (Rob)
Facebook: Waylon-Robert-Mills
Lives in Iowa Park, Texas
Iowa Park, Texas
Cullen Wollin
Lives in Lake Mills, Wisconsin
Machine Operator at Seljan Company
Janet Grace Whalen
Facebook: janet.g.whalen
From Dresden Mills, Maine
Went to Brunswick High School '74
Brunswick High School
Lacey Whalen
Facebook: lacey.whalen.1
Lives in Browns Mills, New Jersey
Studied at Rowan College at Burlington County
Works at Massage Envy - Marlton Crossing
Waylon Chen
Facebook: waylon.chen.5
Studied Computer science at University of Toronto Mississauga '13
Product Specialist at Oakville Honda
Peter Karen Wollin
Facebook: peter.wollin.94
Lives in Aztalan, Wisconsin
Went to Lake Mills High School (WI)
Lake Mills High School (WI)
Doug Wollin
Lives in Lake Mills, Wisconsin
Lake Mills, Wisconsin
Susan Wallin
Facebook: susan.wallin.71
Lives in Trion, Georgia
Studied at Trion High School
Works at Mount Vernon Mills
Steven Wollin
Facebook: steven.wollin
Lives in Johnson Creek, Wisconsin
Went to Lake Mills High
Lake Mills High
Leona Parks Wallin
Facebook: leona.p.wallin
Lives in Jackson, Ohio
Studied at Jackson High School
Deputy Clerk at Jackson County Municipal Court
Mark Wei Lin
Facebook: mark.weilin
Lives in Sitiawan
Studied at Universiti Malaysia Sabah
Works at MFM
Janice Mills Whalin
Facebook: janice.whalin
Lives in Modesto, California
Went to Shortridge High School
Shortridge High School
Wilian Barra Comun
Facebook: wilian.barracomun.7
Worked at FINCASURR
Studied at Law
Law
Waylon Webb
Facebook: waylon.webb
Lives in New Castle, Pennsylvania
Studied AAS in Computer Information Systems - Computer Tech Emphasis at Bay Mills Community College '11
Bay Mills Community College
Waylon Olson
Facebook: waylon.olson.56
From Clipper Mills, California
Works at Money
Willann Mills
Facebook: superwomanmills
Lives in Nassau, New Providence
Studied Social work at College of the Bahamas '99
Welfare Officer at Department of Social Services
Jack Wolan
Lives in Adamsville, Florida
Went to Pemberton Twp High School '69
Pemberton Twp High School
Wulan CuayAnx Rakka n'Saddam
Facebook: Wulan-CuayAnx-Rakka-nSaddam
Lives in Salatiga
Studied at Kampus UKSW Salatiga '12
Winding Machine Operator at PT.SPMD SPINNING MILLS, BENER,TENGARAN, KAB.SEMARANG
Willian Molina (Will)
Facebook: willianpmolina
Works at Usina Do Corpo
Studied Physical Education at Unisinos '11
Professor Sh'Bam™ / BodyJam™ at Les Mills Brasil
Brett Whalen
Facebook: brett.whalen.33
Lives in Calgary, Alberta
Studied at University of Calgary
University of Calgary
Daniel Wallen
Facebook: daniel.wallen.144
Lives in West Asheville, North Carolina
Works at Asheville Paint and Powdercoat
Wulan Anggraini
Accounting Officer at PT. Nagasakti Kurnia Textile Mills
Studied Akuntansi S1 at STIE WIDYA MANGGALA SEMARANG '15
Works at PT.NAGASAKTI KURNIA TEXTILE MILLS
Janelle Whelan
Facebook: janelle.millswhelan
Lives in Spreyton, Tasmania
Went to Sheffield High School
Sheffield High School
Brian Whalen
Lives in Caddo Mills, Texas
Studied Communications at UConn '91
Owner-operator at KYTEX Shooting Gear
Waylon Chen
Studied at University of Waterloo '15
Research Assisstant at The Petroleum Institute
April Mills Wallen
Facebook: april.m.wallen
Lives in O'Fallon, Illinois
Assistant Teacher at River Dell Elementary School
Wulan Setiawati
Facebook: wulan.setiawati.10
Lives in Cikarang, Jawa Barat, Indonesia
Studied at stmik mardira indonesia komputer akuntansi diploma 3. '11
DIRUT at IIRTRI(Ikatan Ibu Rumah Tangga Republik Indonesia)
Milla Wilén
Lives in Mickelspiltom, Etelä-Suomen Lääni, Finland
Studied at Östra Nylands yrkesinstitut Inveon
Works at Kuljetusliike Kim-Johan Nuikka Oy
Wulan Nuryanti
Facebook: WulanNuryanti26
Lives in Bandung
Studied at Universitas Padjadjaran
Operator at PT. Indo Everest Texindo
Claire Whalen
Facebook: Claire-Whalen
Worked at Baker Street Pub
Studied at Beech High School Athletics
Beech High School Athletics
Wulan Permata Dara'cii PinkySweetylovelystraberry
Facebook: wulan.permatadaraciipinkysweetylovelystraberry
Bendahara at Sekretaris di PT cinta abadi
Went to sma n 1 baturetn0 '06
Works at PT World Yamatex Spinning Mills
Michelle Whalen
Facebook: michelle.maderwhalen
Went to Don Mills Collegiate Institute
Don Mills Collegiate Institute
Waylon Mills
Facebook: waylon.mills.79
Electrician at All over the land
Waylon Mills
Facebook: waylon.mills.756
Worked at AAA
Studied at Vaughn College of Aeronautics and Technology
Vaughn College of Aeronautics and Technology
Carol Swezy Connor Whalen
Facebook: carolswezyconnor.whalen
Retired
Studied at The University of Alabama
The University of Alabama
Mia Wollin
Facebook: mia.wollin
Lives in Lake Mills, Wisconsin
Studied Finance at UW Whitewater '01
Star Director at Mia Wollin, Independent Scentsy Consultant
Wilan Ponte
Facebook: wilan.ponte.3
Lives in Swan Hill, Victoria
Studied at University of Pennsylvania
University of Pennsylvania
Waylon Olson
Facebook: waylon.olson.5
Lives in Oklahoma City, Oklahoma
constrution at constuctoin
Wulan Gavriel
Facebook: landz.siigadshu
Lives in Bandung
Went to SMK 1 LPPM RI Majalaya '10
Staff Administrasi at PT.Indopacific
Willian Samia
Facebook: willian.olivera.12
Lives in Ribeirão Preto
Studied at ETEC José Martimiano da Silva
Proprietário at W.s Prestadora de serviços LTDA
Wilian Dos Santos
Facebook: wilian.dossantos.779
Lives in Cubatão
Works at Mills
Waylon Shewmaker
Facebook: waylon.shewmaker
Lives in Jefferson City, Missouri
Jefferson City, Missouri
Whalon Jones
Facebook: whalon.jones.1
Lives in Tupelo, Mississippi
Went to Hackleburg High School
Sanitation Manager at Sunshine Mills/World Pet Care

1 Waylon Mills's websites and domain names

Domain
Registrar Data
captwaylon.net registered by Waylon Mills
blazetarpon21@gmail.com
Create / update date: 05-mar-2013 / 07-mar-2013
Registrar: WILD WEST DOMAINS, LLC
8860 CALUMET BLVD Port Charlotte Alabama 33981, UNITED STATES
19412700289


Types of Data You Can Find


Social Profiles

Business Registration

Education Records

Addresses, Phones

Marketing Data

Whois Records

Contacts, Relatives

Donations Records

Real Estate

Car Registration