Murray Decker - we found 79 people search records: 15 addresses & phone numbers, 2 Murray Decker's cars, 57 CVs and social profiles

3 Murray Decker's phone numbers & addresses

Name
Address
County
Phone
Murray Decker
PO BOX 983, MENARD, TX, 76859
MENARD
(325) 396-2425
Murray Decker
6360 98TH ST, REGO PARK, NY, 11374
QUEENS
(718) 459-5109
Murray Decker
23 TOWNE RD, MADISON, ME, 4950
SOMERSET
(207) 696-8254

2 VINs of Murray Decker's cars

Name
Address
Phone
Car Model
VIN
Murray Decker
2360 DOVER, WESTON, FL 33326-2324
(954) 349-2210
Car Model 2008 LEXUS LS 460
VIN JTHGL46F385024492
Murray Decker
2360 Dover, Weston, FL 33326-2324
(954) 349-2210
Car Model 2012 LEXUS LS 460
VIN JTHGL5EF3C5045715

12 Murray Decker's home addresses and relatives

Name
Address
Contacts
Possible Relatives
Murray Marty Decker
6184 Happy Ln,Nampa, ID 83686
Possible relatives
Marty Murraydecker, Emily Martelle Decker, Nicholas Rodney Decker, Rachel Elaine Decker, Michael Decker, Mark Edwin Decker, Martelle Davis Murray, Sarah Elizabeth Decker
Murray E Decker
23 Towne Rd,Madison, ME 04950
Former addresses:
3355 RR 2 POB, Oakland, ME 04963
3355 RR 1, Smithfield, ME 04978
3355 RR 2, Oakland, ME 04963
RR 2 CHATHAM CENTER, Oakland, ME 04963
Possible relatives
Murray E Decker, Carol L Decker, Elwood F Decker
Murray Steven Decker
15352 Castanet Dr,La Mirada, CA 90638
Former addresses:
7523 Lakewood Dr, Tacoma, WA 98499
4814 86th Avenue Ct, Tacoma, WA 98467
13800 Biola Ave #1950, La Mirada, CA 90639
13800, La Mirada, CA 90639
Horton Res Dir, La Mirada, CA 90639
13800 Biola #1950, La Mirada, CA 90639
(562) 947-4784
Former phone numbers:
(562) 947-4784
(714) 402-1105
(562) 903-6415
Possible relatives
Monte R Decker, Alice E Decker, Mary Deann Decker, Donald Irev Decker
Murray Ruth Decker
1500 650,Attica, IN 47918
Former addresses:
707 900, West Lafayette, IN 47906
84 Cor Dale Ct, Lafayette, IN 47904
4942 Kathy Ln, West Lafayette, IN 47906
2265 780, Wingate, IN 47994
1428 900 #900, Battle Ground, IN 47920
1428 900 #100, Battle Ground, IN 47920
(765) 385-2095
Former phone numbers:
(765) 742-0040
(765) 385-2095
Possible relatives
Kathleen R Murray, Stephen L Murray, Chad A Scott, Sharon Joyce Scott, Marvin R Scottsr
Associated names
Ruth Ann Miller, Ruth A Murray, Ruth A Scott, Ruth A Deckermurray
Murray Decker
2798 Ag,Menard, TX 76859
Murray Decker
2146 County Road 32,Risingsun, OH 43457
Possible relatives
Shane A Decker, Joanne T Decker, Danny D Decker
Murray E Decker
2800 Taney Rd,Baltimore, MD 21209
Former addresses:
667 Main St #308, Worcester, MA 01610
106 Illinois St, Worcester, MA 01603
65 Water St, Waterville, ME 04901
54 Elliot St, Worcester, MA 01605
667 Main St, Worcester, MA 01610
(508) 753-5071
Former phone numbers:
(207) 872-0553
Murray Decker's emails
ev_decker@bellsouth.net, ev_decker@comcast.net, ev_decker@pacbell.net, evdecker@comcast.net, evdecker@msn.com, evdecker1@comcast.net, evdecker2@comcast.net
Possible relatives
Heidi Decker, Mary E Fdecker, Mary L Decker, Ev Decker, Carrol L Hunnewell, Murray E Fdecker, Elwood Frank Decker
Associated names
Murray Decker
Murray E Decker
23 Towne Rd,Madison, ME 04950
Former addresses:
3355 RR 2 POB, Oakland, ME 04963
3355 RR 2, Oakland, ME 04963
Possible relatives
Elwood F Decker, Murray E Decker, Carol L Decker
Associated names
Mary L Decker
Murray N Decker
2360 Dover,Weston, FL 33326
Former addresses:
784 Sherwood St, Valley Stream, NY 11581
3011 Oaktree Ln, Hollywood, FL 33021
2781 Ocean Ave, Brooklyn, NY 11229
128 Monroe Ave, Brockport, NY 14420
(954) 349-2210
Former phone numbers:
(954) 384-1525
(954) 349-2210
Murray Decker's emails
almar@bellsouth.net, almar@bellsouth.ney, almar@cs.com, almar66@bellsouth.net, lmar66@aol.com
Possible relatives
Marki Decker, Rdele H Decker, Alisa B Decker, Adele H Decker, Adele H Decker
Murray Leo Decker
3M Nw,Menard, TX 76859
Murray Leo Decker
983 PO Box,Menard, TX 76859
Former addresses:
33225 PO Box, Austin, TX 78764
(325) 396-2425
Former phone numbers:
(915) 396-2425
(325) 660-6911
Murray Decker
6360 98th St #C2,Rego Park, NY 11374
Former addresses:
6360 98th St, Flushing, NY 11374
6360 98th St #C, Flushing, NY 11374
6360 98th St, Rego Park, NY 11374
(718) 459-5109
Former phone numbers:
(718) 459-5109
Possible relatives
Shirley Decker, Shirley Decker, Shirley Decker, Shirley Decker, Shirley Decker

2 CVs by Murray Decker

murray decker
United States
Murray Decker
Financial Services Professional
Financial Services
Miami/Fort Lauderdale Area

Murray Decker's net worth and financial records

Name, Address, Phone
Marketing Data
Murray Decker
15352 Castanet Dr La Mirada CA 90638 -2403
(562) 947-4784
successfulagain@yahoo.com
Home owner source: Verified Home Owner
Income - estimated household: $100,000 - $149,999
Estimated Mr. Murray S Decker net worth: $250,000 - $499,999
Lines of credit (trade counter): 1 Lines
Range of new credit: Greater than $9,999
Education: Completed Graduate School
Ethnic group: Western European
Murray Decker
2360 Dover Fort Lauderdale FL 33326 -2324
(954) 349-2210
almar1@bellsouth.net
Home owner source: Verified Home Owner
Income - estimated household: $250,000 +
Estimated Mr. Murray N Decker net worth: Greater than $499,999
Lines of credit (trade counter): 4 Lines
Range of new credit: Greater than $9,999
Education: Completed Graduate School
Ethnic group: Western European

55 Murray Decker's Social Profiles

Mary Tucker
Facebook: mary.tucker.18488
Lives in Freetown, Sierra Leone
Studied at Université Félix Houphouët-Boigny
Université Félix Houphouët-Boigny
Mari Decor
Facebook: Mari-Decor
Self-employed
Studied Management at UNISC
Owner at Self-employed
Murray Tucker
Facebook: murray.tucker.58
Lives in Bowmanville, Ontario
Went to Courtice High School
Works at JVH Masonry
Digger Murray
Facebook: Digger-Murray
Lives in Woodstock, Ontario
Sales Associate at Anderson Kia
Mara Decor
Facebook: maradecor.perdele
Lives in Luduș
Designer at Mara Decor
Mery Dekker
Studies at UMSS "Universidad Mayor de San Simón"
UMSS "Universidad Mayor de San Simón"
Mario Düker
Facebook: mario.duker.1
Lives in Brakel, Germany
Owner at Marios Diner
Maria Christine Ticar (Tintin Payat🔫😋😏☺💘😘)
Facebook: aqucii.christine
From Puerto Princesa City, Puerto Princesa, Philippines
Went to Palawan National School (PNS)
Palawan National School (PNS)
Mary Decker
Facebook: mary.decker.31
Lives in Bowling Green, Kentucky
Bowling Green, Kentucky
Maria Décor
Facebook: Maria-Décor
Lives in Blida
Blida
Mary Decker
Facebook: mary.coughran
Lives in St. Louis
Studied at Meramec Community College
Sales Consultant at Paparazzi Jewelry
Maary Decker
Facebook: Juka.Maary
Lives in Lages
Studies at Enfermagem Uniplac '18
Enfermagem Uniplac
Marya Decker
Facebook: AvalancheMyHorse
Lives in La Crosse, Wisconsin
Registered nurse at Gundersen Health System
Meyre Tucker
Facebook: meyre.tucker
Lives in Pôrto Velho
Studied at 21 de abril
21 de abril
Mauro YehicKo Daguer (Mau )
Facebook: Mauro-YehicKo-Daguer
Studied at Facultad de Contaduria y Administración uamex
Facultad de Contaduria y Administración uamex
Maria Decker
Facebook: Maria-Decker
Lives in Jaraguá do Sul
Jaraguá do Sul
Maro Toygar
Facebook: sholycarogamarra
Lives in Cartagena, Bolivar
Went to inedusarli '12
inedusarli
Maria Tucker
Self-employed
Studied at Arthur Findlay Spiritualist College, Stansted
Head Honcho! at Self-employed
Murray Decker
Facebook: Murray-Decker
Lives in New York, New York
Went to Lafayette High School
Lafayette High School
Mariah Tucker (Mariah Marie Tucker)
Facebook: bella.vita.98499
Studied at University of Detroit Mercy
University of Detroit Mercy
Mari Tekir (Kuyumcu)
Lives in Moda, Istanbul, Turkey
Moda, Istanbul, Turkey
Maria Tecar
Facebook: maria.tecar.1232
Lives in Dej
Studied at Universitatea Babeş-Bolyai
Operator at Geil GbR Gemüseanbau
Tucker Murray
Facebook: tuckerandmurraymemorialride
Worked at The National Guard
Went to Celina High School
Celina High School
Marwa Deker
Facebook: mimoXroro
Studied at universite libanaise faculte de pedagogie
universite libanaise faculte de pedagogie
Murray Arthur Decker
Works at DB Schenker
Murray Decker
Facebook: murray.decker.94
Lives in Brisbane, Queensland, Australia
Brisbane, Queensland, Australia
Mary Elizabeth Decker Gray
Server at The Woods at Bear Creek
Works at Holiday Valley Resort
Murray Decker
Facebook: murray.decker.1
Retired
Studied at Did not attend any
Did not attend any
Mariah Tucker
Facebook: mariah.tucker.142
Lives in Lincoln, Nebraska
Went to Sequioa Choice '07
Food Service Assistant at Community Action Partnership of Lancaster and Saunders Counties
Murray Tocker
Facebook: Murray.tocker1
Lives in Cape Town, Western Cape
Went to King David High School, Linksfield
Owner at Durr Estates - False Bay
Maria Dogar
Lives in Faisalabad
Works at Clinical Psychologist
Eileen Murray Decker
Facebook: eileen.murraydecker
Lives in Sunrise Beach, Missouri
Server at Franky & Louie's Beach Front Bar & Grill
Mario Decker
Facebook: mario.decker.92
From Salzburg, Austria
Murray Tucker
Lives in Melbourne, Victoria, Australia
Melbourne, Victoria, Australia
Mary Elizabeth Tucker
From Murfreesboro, Tennessee
Studied Communications at MTSU '16
Impact Specialist at Special Kids Therapy & Nursing Center
Murray Tucker
Facebook: BiggMurr
Studied Firefighter at Utah Valley University '09
Small Business Consultant/Financial Strategis at Apply Knowledge Institute
Marie Dugger
Facebook: anayaprettygirlswagfarmer.farmer
Lives in Raleigh, North Carolina
Works at Doing Hair
Mariah Tucker
Cashier at Whitetail Resort
Went to Berkeley Springs High School '14
Hostess at Denny's
Mari Tucker
Studied at UNLV <3 '00
UNLV <3
Sue Murray-Decker
Facebook: sue.murraydecker
Lives in Galloway, New Jersey
Studied Teacher's Education at Jolie Hair and Beauty Academy '14
Senior Esthetician at Ulta Beauty
Mariah Decker
Lives in Catskill, New York
Went to Catskill Senior High School '12
Catskill Senior High School
Murray Tucker
Facebook: murray.tucker.31
Lives in Guelph, Ontario
Studied Business Administration at Wilfrid Laurier University '93
Works at Visual artist
Murray Decor
Facebook: murray.decor
Lives in Hamilton, South Lanarkshire
Worked at Murray Decor & Home Improvements
Hamilton, South Lanarkshire
Murray Tucker
Facebook: murray.tucker.39
Worked at Young Money
Went to Eastern Goldfields College
Eastern Goldfields College
Murray Decker
Facebook: murray.decker.7
Retired
Studied at Shvatzstrassen Fine Art
Shvatzstrassen Fine Art
Maria Dogar
Facebook: maria.dogar.5074
Lives in Karachi, Pakistan
Works at Student Of The Year
Joni Decker (Joni Murray-Decker)
Facebook: Joni.Murray.Decker
From Minneapolis, Minnesota
Mira Dakar
Studied at Damascus University
Damascus University
Maria Dogar
Facebook: Maria-Dogar
Lives in Pozoblanco, Spain
Works at covap
Murray Decker
Facebook: Murray-Decker
Lives in Deptford, New Jersey
Deptford, New Jersey
Murray W. Decker (Tanker)
Facebook: murray.w.decker
Retired
Works at Retired
Mira Dekar
Facebook: de.kar.16
Worked at PT. United Steel Center Indonesia
Studied at ACADEMY FOOTBALL LA MASIA BARCELONA
ACADEMY FOOTBALL LA MASIA BARCELONA
Maria Tauqir
Lives in Lahore, Pakistan
Studied at University of Central Punjab
Works at Beaconhouse Newlands
Allison Murray Tucker
Facebook: allison.m.tucker.9
Studied at University of Texas at El Paso
University of Texas at El Paso
Maria Dekker
Facebook: maria.dekker1
Lives in Steenwijk
Studied at RSG Tromp Meesters
RSG Tromp Meesters

3 Murray Decker's websites and domain names

Domain
Registrar Data
tourtravelcompare.com registered by Murray Decker
murraydecker1@gmail.com
Create / update date: 24-mar-2013 / 24-mar-2013
Registrar: WEBFUSION LTD.
15 Lautrec Street Brisbane QLD 4017, AUSTRALIA
61732612991
dekkertrek.com registered by Murray Decker
murraydecker1@gmail.com
Create / update date: 12-dec-2013 / 12-dec-2013
Registrar: WEBFUSION LTD.
15 Lautrec Street Bracken Ridge QLD 4017, AUSTRALIA
61732612991
deckertrek.com registered by Murray Decker
murraydecker1@gmail.com
Create / update date: 12-dec-2013 / 12-dec-2013
Registrar: WEBFUSION LTD.
15 Lautrec Street Bracken Ridge QLD 4017, AUSTRALIA
61732612991


Types of Data You Can Find


Social Profiles

Business Registration

Education Records

Addresses, Phones

Marketing Data

Whois Records

Contacts, Relatives

Donations Records

Real Estate

Car Registration