Larry Franklin All 332 Business Registration 74Facebook Profiles 40Donations Records 40Marketing Data 30Car Registrations 25Contacts, Possible Relatives 25Addresses, Phone Numbers 25US Voter Database 25LinkedIn Profiles 20Real Estate 13Whois Records 12White House Visitors 3

Larry Franklin Facebook Profiles

Larry Franklin facebook profile
Larry Franklin
Lives in Hot Springs, Arkansas
Hot Springs, Arkansas
Larry Franklin facebook profile
Larry Franklin
Licensed Insurance Sales Agent at USHEALTH Advisors
Larry Franklin (LJ) facebook profile
Larry Franklin (LJ), Larry-Franklin
Lives in Youngstown, Ohio
Went to Valley Christian Schools
Lineman at NFL
Larry Franklin facebook profile
Larry Franklin, larry.franklin.3975
Retired
Went to Dunbar High School Lubbock '67
Dunbar High School Lubbock
Larry Franklin facebook profile
Larry Franklin, larry.franklin.906
Lives in Clarksburg, Maryland
Went to Seneca Valley High
Works at Larry Franklin - Re/max Realty Centre
Larry Franklin facebook profile
Larry Franklin, larry.franklin.5264
From Dix Hills, New York
Larry Franklin facebook profile
Larry Franklin, larry.franklin.902
Worked at Oneida Indian Nation
Studied at Herkimer County Community College
Herkimer County Community College
Larry Franklin facebook profile
Larry Franklin
Went to Weir High School
Weir High School
Larry Franklin facebook profile
Larry Franklin
Former Director of Engineering at Hyatt Regency Morristown
Went to Franklin High School '75
Franklin High School
Larry Franklin facebook profile
Larry Franklin, larry.franklin.332
Lives in Wichita, Kansas
Wichita, Kansas
Larry Franklin facebook profile
Larry Franklin
Lives in Knoxville, Tennessee
Knoxville, Tennessee
Larry Franklin facebook profile
Larry Franklin
Lives in Longmont, Colorado
Longmont, Colorado
Larry Franklin facebook profile
Larry Franklin
Lives in Traverse City, Michigan
Went to Central High School '12
Central High School
Larry Franklin facebook profile
Larry Franklin, larry.franklin.18
Lives in Crocker, Missouri
Studied at Crocker High
Crocker High
Larry Franklin facebook profile
Larry Franklin
Overton High School
Larry Franklin facebook profile
Larry Franklin, Larry-Franklin
Lives in Las Cruces, New Mexico
Studied Aerospace Science at Eastern New Mexico University '11
Eastern New Mexico University
Larry Franklin facebook profile
Larry Franklin, larry.franklin.961
Lives in Livonia, Michigan
Livonia, Michigan
Larry Franklin facebook profile
Larry Franklin
Lives in Kansas City, Missouri
Studied at University of Missouri
Works at CSRA Inc.
Larry Franklin facebook profile
Larry Franklin
Studied at The University of Kansas '05
The University of Kansas
Larry Franklin facebook profile
Larry Franklin
Lives in South Bend, Indiana
South Bend, Indiana
Larry Franklin facebook profile
Larry Franklin, larry.franklin.69
Former Chaplain at KY Department of Corrections - Retired
Studied at Liberty University
Liberty University
Larry Franklin facebook profile
Larry Franklin
Lives in Whitesburg, Georgia
Whitesburg, Georgia
Larry Franklin facebook profile
Larry Franklin, larry.franklin.33821
Lives in Pearl, Mississippi
Went to Forest Hill High School, Jackson, MS '84
Forest Hill High School, Jackson, MS
Larry Franklin facebook profile
Larry Franklin, larry.franklin.9465
Lives in Spring Hill, Florida
Spring Hill, Florida
Larry Franklin facebook profile
Larry Franklin
Lives in Denison, Texas
Denison, Texas
Larry Franklin facebook profile
Larry Franklin, larry.franklin.399
Self-Employed
Went to Union County High School '78
Works at Self-Employed
Larry Franklin facebook profile
Larry Franklin
Went to Lowell High School
Manufacturing Manager at Curtiss-Wright Controls
Larry Franklin facebook profile
Larry Franklin, larry.franklin.102
Retired
Studied at Northeastern University '68
Chief executive officer at Retired
Larry Franklin facebook profile
Larry Franklin, larry.franklin.3511
Lives in Alton, Illinois
Went to Roxana Senior High School
Roxana Senior High School
Larry Franklin facebook profile
Larry Franklin, larry.franklin.735944
Self-Employed
Went to Jesup W. Scott High School
Works at Self-Employed
Larry Franklin facebook profile
Larry Franklin, larryofranklin
From Wodonga, Victoria
Larry Franklin facebook profile
Larry Franklin, larry.franklin.180
Lives in Dallas, Texas
Dallas, Texas
Larry Franklin facebook profile
Larry Franklin, Larry-Franklin
Lives in Topeka, Kansas
Self-Employed
Chief executive officer at Self-Employed
Larry Franklin facebook profile
Larry Franklin, larry.franklin.796
Lives in Joliet, Illinois
Joliet, Illinois
Larry Franklin facebook profile
Larry Franklin
Lives in Atlanta, Georgia
Went to Headland High School '06
Works at Walmart Dothan - S Oates St
Larry Franklin (Buck Redbud) facebook profile
Larry Franklin (Buck Redbud)
Lives in Carrollton, Kentucky
Works at North American Stainless
Larry Franklin facebook profile
Larry Franklin
Lives in Middleburg, Florida
Went to Middleburg High School '90
Security Consultant/Analyst at Secure Ideas
Larry Franklin facebook profile
Larry Franklin, larry.franklin.5688
Retired
Studied at Chadron State College
Works at Retired
Larry Franklin facebook profile
Larry Franklin, larry.franklin.3150
Lives in Vancouver, British Columbia
Studied at University of Guelph '76
Sales Manager at Queen Charlotte Lodge
Larry Franklin facebook profile
Larry Franklin, Larry-Franklin
Retired
Went to Davenport Central High School
Works at Retired

Larry Franklin LinkedIn Profiles

Larry D. Franklin Jr. linkedin profile
Larry D. Franklin Jr.
Production Oracle DBA at IBM
Information Technology and Services
Greater Atlanta Area
Larry D Franklin linkedin profile
Larry D Franklin
United States
Larry D Franklin linkedin profile
Larry D Franklin
Full Time Minister
Religious Institutions
Greater Chicago Area
Larry Franklin Crowe linkedin profile
Larry Franklin Crowe
Oral Historian/Artist
Fine Art
Dayton, Ohio Area
Larry Franklin Jr. linkedin profile
Larry Franklin Jr.
owner/operator at larry's barber shop
Lawrence, Kansas Area
Larry J. Franklin linkedin profile
Larry J. Franklin
Pastor, Entrepreneur, Motivational Speaker, Trainer, IT Professional, Network Marketing Professional
Information Technology and Services
Washington D.C. Metro Area
Larry Franklin Jr linkedin profile
Larry Franklin Jr
ROV Supervisor at Helix Canyon Offshore
Oil & Energy
Houston, Texas Area
larry franklin linkedin profile
larry franklin
Manufacturing Manager at OnCore Manufacturing Services, LLC
Information Technology and Services
Greater Boston Area
Larry Franklin linkedin profile
Larry Franklin
Sr. Oracle DBA (Contract) at Blue Cross Blue Shield of North Dakota
Information Technology and Services
Greater Atlanta Area
Larry Franklin linkedin profile
Larry Franklin
Author
Writing and Editing
Greater St. Louis Area
Larry Franklin linkedin profile
Larry Franklin
Owner
Consumer Services
Spring Hill, Florida
Larry Franklin linkedin profile
Larry Franklin
Sr. Risk Engineering Consultant at Zurich North America
Construction
Boerne, Texas
Larry Franklin linkedin profile
Larry Franklin
Oil & Energy
Tulsa, Oklahoma Area
Larry Franklin linkedin profile
Larry Franklin
Realtor at Keller Williams Capital Properties
Real Estate
Clarksburg, Maryland
Larry Franklin linkedin profile
Larry Franklin
Manager Programs Branch at Department of the Treasury
Government Administration
Hyattsville, Maryland
Larry Franklin linkedin profile
Larry Franklin
Insurance Sales Representative at Performance Matters Associates
Financial Services
Greater Los Angeles Area
Larry Franklin linkedin profile
Larry Franklin
Pastor at Nazarene Church of Jesus Christ COGIC
Food Production
Warner Robins, Georgia
Larry Franklin Crowe linkedin profile
Larry Franklin Crowe
United States
Larry Lawrence Franklin linkedin profile
Larry Lawrence Franklin
Logistics at General Dynamics
Defense & Space
Upper Marlboro, Maryland
Larry Mr CIV USA TRA Franklin linkedin profile
Larry Mr CIV USA TRA Franklin
Information Technology Specialist at U.S. Army
Information Technology and Services
Fort Eustis, Virginia

Larry Franklin in White House Visitors Database

Name
Visit Date
Visitee Name
Appointment Number
Meeting Location
Caller Name
Total Visitors
LARRY G FRANKLIN
Visit Date 10/14/09 8:30
Visitee Name VISITORS OFFICE
Appointment Number U45804
Meeting Location WH RESIDENCE
Caller Name VISITORS OFFICE
Total Visitors 303
LARRY E FRANKLIN
Visit Date 10/7/10 9:30
Visitee Name VISITORS OFFICE
Appointment Number U44293
Meeting Location WH RESIDENCE
Caller Name VISITORS OFFICE
Total Visitors 306
Larry L Franklin
Visit Date 3/8/14 13:00
Visitee Name VISITORS OFFICE
Appointment Number U57257
Meeting Location WH RESIDENCE
Caller Name VISITORS OFFICE
Total Visitors 275

Larry Franklin in US Voter Database

Name
Address
Phone
E-mail
Party
Larry Franklin
8867 SPRINGHURST DR, ELK GROVE, CA, 95624
(916) 761-9130
larrydfranklin01@gmail.com
Larry Franklin
4306 FENCE PL, LOUISVILLE, KY, 40241
(502) 744-6075
larry.franklin@cs.com
Independent
Larry Franklin
6459 SHAWNEE AVE, LAS VEGAS, NV, 89107
(702) 682-6805
byronvck@aol.com
Independent
Larry Franklin
1305 N LEDLIE AVE, SPRINGFIELD, IL, 62702
(217) 789-6402
larryfranklinsr@yahoo.com
Larry Franklin
3463 COMMENDATION DR, LAS VEGAS, NV, 89117
(702) 412-3292
lasvegaslfrankli@aol.com
Republican
Larry Franklin
1354 LACLEDE AVE, JACKSONVILLE, FL, 32205
(904) 610-7366
lfranklin3146@yahoo.com
Larry Franklin
216 W COLLINS CT, LOUISVILLE, KY, 40214
(812) 267-7420
larry.franklin@gmail.com
Democrat
Larry Franklin
3208 GRANDEUR AVE, ALTADENA, CA, 91001
(626) 791-4301
larrywfranklin@aol.com
Larry Franklin
17625 N 7TH ST APT 2092, PHOENIX, AZ, 85022
(623) 694-6694
larryf@netzero.net
Larry Franklin
9705 WESTERLY AVE, BATON ROUGE, LA, 70814
(225) 924-0347
larryfranklin@att.net
Larry Franklin
21967 CRAIG AVE., NOBLESVILLE, IN, 46060
(317) 849-1467
ngfranklin@earthlink.net
Larry Franklin
1043 BISHOP DR, UTICA, MS, 39175
(601) 826-6103
teresafjamal@aol.com
Independent
Larry Franklin
6459 SHAWNEE AVE, LAS VEGAS, NV, 89107
(702) 592-9476
lfranklin@lycos.com
Democrat
Larry Franklin
3647 HALTER DR, LAS VEGAS, NV, 89122
(702) 595-4078
larry.franklin@adelphia.net
Independent
Larry Franklin
9634 HALLI WAY, ELK GROVE, CA, 95624
(916) 880-5043
larry_66259@yahoo.com
Larry Franklin
718 MISSION CT, FREEPORT, IL, 61032
(815) 761-7947
larry.franklin@worldnet.att.net
Larry Franklin
371 CERRITO PL., MORRO BAY, CA, 93442
(805) 771-8096
lf371@charter.net
Independent
Larry Franklin
1104 NW 61ST AVE, HOLLYWOOD, FL, 33024
(954) 297-6979
larry.franklin@latinmail.com
Larry Franklin
8596 SE ALABAMA PL, HOBE SOUND, FL, 33455
(772) 501-1000
larry.franklin@netzero.net
Larry Franklin
108 WOOD DUCK CIR, LA PLATA, MD, 20646
(301) 537-3697
lucy.franklin@yahoo.com
Democrat
Larry Franklin
23292 N COUNTYLINE RD, NEWAYGO, MI, 49337
(231) 578-0516
larry.franklin9@aol.com
Independent
Larry Franklin
8225 SHALLOWFORD RD, LEWISVILLE, NC, 27023
(336) 945-1149
citync39@yahoo.com
Larry Franklin
740 NW 7TH AVE, FLORIDA CITY, FL, 33034
(305) 588-7925
larry.franklin@att.net
Independent
Larry Franklin
2708 BOSTWICK ST, ALTON, IL, 62002
(618) 465-9008
larryfranklin855@windwarning.com
Republican
Larry Franklin
1435 NATALIE ST, SHREVEPORT, LA, 71108
(318) 631-3745
lfranklin4177@yahoo.com
Independent

Larry Franklin Addresses, Phone Numbers

Name
Address
County
Phone
Larry Franklin
1620 CRUDUP RD, ATTALLA, AL, 35954
ETOWAH
Larry Franklin
838 N ROYAL AVE, FLORENCE, AL, 35630
LAUDERDALE
(256) 740-6664
Larry Franklin
31366 N GECKO TRL, QUEEN CREEK, AZ, 85243
PINAL
Larry Franklin
13915 B T SHORT CUT OFF RD, VANCE, AL, 35490
TUSCALOOSA
Larry Franklin
4414 WOODWARD RD, BESSEMER, AL, 35020
JEFFERSON
Larry Franklin
2202 REGENCY DR, BESSEMER, AL, 35022
JEFFERSON
(205) 428-9251
Larry Franklin
913 RABBITTOWN DR, GADSDEN, AL, 35903
ETOWAH
Larry Franklin
2751 S LOOKOUT AVE, YUMA, AZ, 85365
YUMA
(928) 342-9005
Larry Franklin
11412 S RENEE AVE, YUMA, AZ, 85367
YUMA
Larry Franklin
2150 E 56TH AVE, ANCHORAGE, AK, 99507
ANCHORAGE
Larry Franklin
721 AVENUE H, BIRMINGHAM, AL, 35214
JEFFERSON
(205) 791-3817
Larry Franklin
1336 LEDBETTER RD, MUNFORD, AL, 36268
TALLADEGA
(256) 358-1529
Larry Franklin
712 ARSENAL PL, SELMA, AL, 36701
DALLAS
Larry Franklin
702 COUNTY ROAD 1662, CULLMAN, AL, 35058
CULLMAN
(256) 796-7610
Larry Franklin
PO BOX 7941, SPANISH FORT, AL, 36577
BALDWIN
(251) 626-5345
Larry Franklin
13919 B T SHORT CUT OFF RD, VANCE, AL, 35490
TUSCALOOSA
(205) 477-5955
Larry Franklin
4365 COOK SPRINGS RD, PELL CITY, AL, 35125
SAINT CLAIR
(205) 338-9856
Larry Franklin
913 RABBITTOWN RD, GADSDEN, AL, 35905
ETOWAH
(256) 492-4785
Larry Franklin
7347 W IAN DR, LAVEEN, AZ, 85339
MARICOPA
Larry Franklin
59360 HIGHWAY 17, SULLIGENT, AL, 35586
LAMAR
(205) 698-9586
Larry Franklin
13919 B T SHORT CUT OFF RD, VANCE, AL, 35490
TUSCALOOSA
(205) 477-5955
Larry Franklin
3516 W ORANGE DR, PHOENIX, AZ, 85019
MARICOPA
(602) 973-2514
Larry Franklin
413 BROW DR, GADSDEN, AL, 35904
ETOWAH
(256) 438-5678
Larry Franklin
505 LAGRAND DR, DOTHAN, AL, 36301
HOUSTON
Larry Franklin
7023 E THUNDERBIRD DR APT A, TUCSON, AZ, 85708
PIMA
(520) 747-0679

Larry Franklin's Real Estate

Name
Owner Address
Real Estate Address
Value
Year of construction
FRANKLIN LARRY
1365 W 34THST ST, RIVIERA BEACH, FL 33404
Real Estate Address
1365 W 34TH ST, WEST PALM BEACH, FL 33404
Value $40,525
Year of construction 1956
FRANKLIN LARRY F G & ALYCE F
1954 HARVEST WAY, MIDDLEBURG, FL 32068
Real Estate Address
1954 HARVEST WAY, MIDDLEBURG, FL 32068
Value $81,876
Year of construction 2007
FRANKLIN, LARRY S
2809 5TH ST SE, MOULTRIE, GA 31768
Real Estate Address
9900 THOMAS DR S 1501, PANAMA CITY BEACH, FL 32408
Year of construction 2007
FRANKLIN LARRY J
129 CHICAGO CIR, ORLANDO, FL 32824
Real Estate Address
HOLOPAW GROVES RD, SAINT CLOUD, FL 34771
FRANKLIN, LARRY B.
164 WESTWOOD BLVD, WESTWOOD, NJ, 07675
Real Estate Address
164 WESTWOOD BLVD, WESTWOOD, NJ, 07675
Value $380,400
FRANKLIN LARRY
4170 BERGAMONT CT, KISSIMMEE, FL 34746
Real Estate Address
4170 BERGAMONT CT, KISSIMMEE, FL 34746
Value $70,900
Year of construction 1988
FRANKLIN LARRY B
Real Estate Address
1800 ATLANTIC BLVD, KEY WEST, FL 33040
Year of construction 1984
FRANKLIN LARRY L TRUST
4380 ANSON DR, JACKSONVILLE, FL 32246
Real Estate Address
4380 ANSON DR, JACKSONVILLE, FL 32246
Value $61,891
Year of construction 1980
FRANKLIN, LARRY H
1128 NELSON ST, DUNEDIN, FL 34698
Real Estate Address
1472 FRESH DR, DUNEDIN, FL 34698
Year of construction 1971
FRANKLIN LARRY KENNETH
4612 BEAUCHAMP RD, PLANT CITY, FL 33563
Real Estate Address
4612 BEAUCHAMP RD, PLANT CITY, FL 33563
Value $90,636
Year of construction 1969
FRANKLIN, LARRY A
7100 ULMERTON RD LOT 400, LARGO, FL 33771
Real Estate Address
7100 ULMERTON RD # 400, LARGO, FL 33771
Value $49,000
Year of construction 1972
FRANKLIN LARRY
3337 FRIDINGER DR, PENSACOLA, FL 32526
Real Estate Address
3337 FRIDINGER DR, PENSACOLA, FL 32526
Value $97,711
Year of construction 1976
FRANKLIN LARRY STEVE
1759 COUNTRY WALK DR, MOULTRIE, GA 31768
Real Estate Address
1759 COUNTRY WALK DR, FLEMING ISLAND, FL 32003
Value $283,339
Year of construction 1997

Larry Franklin addresses, contacts, age, possible relatives

Name
Born in
Address
Contacts
Possible Relatives
Larry H Franklin
52218 PO Box,Lafayette, LA 70505
Larry Dean Franklin
Born in 1959
1435 Natalie St,Shreveport, LA 71108

Former addresses
3120 Stonewall St, Shreveport, LA 71109
3112 Darien St, Shreveport, LA 71109
(318) 865-1141

Former phone numbers
(318) 636-4967
Larry G Franklin
Born in 1937
2316 Arkansas Ave,Van Buren, AR 72956

Former addresses
343 PO Box, Van Buren, AR 72957
3628 46th St, Fort Smith, AR 72904
413 PO Box, Van Buren, AR 72957
413 RR 3, Van Buren, AR 72956
343 RR 3, Van Buren, AR 72956
(479) 474-0994
Larry K Franklin
Born in 1962
1637 Cooper Rd #C,Gretna, LA 70056

Former addresses
1413 Oconnor St, Gretna, LA 70053
1572 Conti St #C, New Orleans, LA 70112
1413 Connor #O, Gretna, LA 70053
(504) 367-2692
Paquita Y Franklin
Larry C Franklin
Born in 1948
612 Abbott Ave,Leominster, MA 01453

Former addresses
18 Norman Pl, Leominster, MA 01453
(978) 345-2396

Former phone numbers
(978) 345-3948
Larry J Franklin
Born in 1949
1301 Cambronne St,New Orleans, LA 70118
Larry J Franklin
Born in 1951
17 Campanelli Pkwy,Stoughton, MA 02072

Former addresses
178 Braemoor Rd, Brockton, MA 02301
96 Monadnock Rd Chestnut, Hill, MA 02167
508 PO Box, Stoughton, MA 02072
96 Monadnock Rd, Chestnut Hill, MA 02467
85 Yarmouth Rd, Chestnut Hill, MA 02467
62 Bishop Rd, Sharon, MA 02067
(781) 344-1111

Former phone numbers
(617) 731-5885
(617) 332-2988
A Franklin
Sports Ind Franklin
Irving H Franklin
Cheryl Lynn Franklin
Arlene S Franklin
Nc Franklinsports
Ndustries I Franklinsports
Adam J Franklin
Jared C Franklin
Larry Eugene Franklin
Born in 1958
1312 Stokley Pl,Baton Rouge, LA 70815

Former addresses
2605 68th Ave, Baton Rouge, LA 70807
4347 Woodlawn Ave, Baton Rouge, LA 70805
8770 Elmgrove Garden Dr #241, Baton Rouge, LA 70807
957 Grebe St #7, Baton Rouge, LA 70807
5831 Crown Ave, Baton Rouge, LA 70811
4423 Beech St, Baton Rouge, LA 70805
3112 Midway Ave #B, Baton Rouge, LA 70805
2254 70th Ave, Baton Rouge, LA 70807
3011 Sycamore St, Baton Rouge, LA 70805
(225) 771-1608

Former phone numbers
(225) 355-0578
(504) 357-2037
Larry Freddie Franklin
Born in 1974
1954 Harvest Way,Middleburg, FL 32068

Former addresses
885 Johns Ave, Orange Park, FL 32065
986B Eldorado St, Jacksonville, FL 32227
5444 Lemay Ave #A, Buzzards Bay, MA 02542
5444 Lemay Ave, Buzzards Bay, MA 02542
3220 Holly Berry Ln, Jacksonville, FL 32277
54440 Lemay, Buzzards Bay, MA 02542
5444 Lemay Ave #C, Buzzards Bay, MA 02542
2312 Oakmere Dr, Harvey, LA 70058
(904) 406-5636

Former phone numbers
(904) 744-4854
(318) 381-5504
(904) 272-8943
(504) 340-5160
(904) 406-5636
(904) 744-4854
(504) 340-5160
Alyce E Franklin
Wanda C Franklin
Alyce Framke Franklin
Luther Leland Franklin
Samuel W Frank
Cindy Gibboney
Gina Franklin
Saundra I Franklin
Annette J Currier

Associated names
Larry G Franklin
Larry E Franklin
4665 Shelley St,Baton Rouge, LA 70805
Larry L Franklin
Born in 1955
1810 Valentine St,Little Rock, AR 72204
(501) 376-2122

Former phone numbers
(501) 661-0673
Larry E Franklin
Born in 1953
489 Round Top Rd #F,Harrisville, RI 02830

Former addresses
63 Round Top Rd, Harrisville, RI 02830
(401) 568-4935

Former phone numbers
(401) 568-4935
(401) 568-3128
(401) 568-3128
Larry Charles Franklin
Born in 1973
7023 Thunderbird Dr,Tucson, AZ 85708

Former addresses
8031 16th Ave #B, Anchorage, AK 99504
1456 Psc 1456, Chanute Afb, IL 61868
8251 Placita Del Parque #D, Tucson, AZ 85747
31160 Myrtle #4027, Elmendorf Afb, AK 99506
7351 Speedway Bl #6B, Tucson, AZ 85710
900 19th St, Monroe, LA 71201
31160 Myrtle Stop St #4027, Elmendorf Afb, AK 99506
638 6th Ave #A, Tacoma, WA 98405
638 6th #B, Mc Chord Air Force Base, WA 98438
8031 16th Ave #A, Anchorage, AK 99504
6940 Roswell Rd, Atlanta, GA 30328
516 Baily 34, Jacksonville, AR 72076
80001 PO Box, Davis Monthan Afb, AZ 85707
157 Mississippi Loop, Jacksonville, AR 72076
638 6th Ave #B, Tacoma, WA 98405
2107 Sumpter St, Houston, TX 77026
516 Bailey St #34, Jacksonville, AR 72076
8031 16th Ave, Anchorage, AK 99504
(520) 664-0479

Former phone numbers
(318) 323-9773
(520) 747-0679
(206) 588-5721
(907) 338-9516
(520) 747-0679
(520) 664-0479
(713) 225-1469


Possible e-mails
larryfranklin1@cox.net
Tiffiny N Andersonfranklin
Willie L Campbell
Glorya L Franklin
Tiffinay N Franklin
Angela Faye Frank
Nathaniel Franklin
Anthony Frank
Connie Michelle Boulware
Janemarie Hinderksshepherd
Larry A Franklin
Born in 1959
14 Forsythia Dr,Harwich, MA 02645

Former addresses
19 Marlin Way, South Yarmouth, MA 02664
12 Herring Run Rd, Harwich, MA 02645
19 Marlin Way, S Yarmouth, MA 02664
(508) 432-8716

Former phone numbers
(508) 951-6078
(508) 432-8716
Larry Humphries Franklin
Born in 1970
1600 Dogwood St,Rogers, AR 72758

Former addresses
3701 Doctor Scott Rd, Del Valle, TX 78617
6212 Horton Cir #F, Fort Worth, TX 76133
14801 Royal Oak Dr, Little Rock, AR 72210
7428 Tallow Wind Trl #A, Fort Worth, TX 76133
808 Durham Pl, Bentonville, AR 72712
4357 Worden Ave #A, Springdale, AR 72762
36 Chapel Ln, Bella Vista, AR 72715
1705 Sherryden Dr, Rogers, AR 72758
6000 Shepherd Mountain Cv #2209, Austin, TX 78730
(479) 986-9350

Former phone numbers
(479) 886-9350
(479) 970-0800
(817) 271-0950
(479) 986-9350
(501) 455-4888
(501) 455-4888
Sarah Elizabeth Anderson
Laryn G Phillips
Brad Franklin
Sarah Elizabeth Franklin
B Franklin
Charladean Revo Franklin
Larry Brad Franklin

Associated names
Larry Brad Franklin, Larry Bradley Franklin, Laryn G Franklin
Larry L Franklin
Born in 1946
3401 Transcontinental Dr #A,Metairie, LA 70006

Former addresses
3105 Independence St, Metairie, LA 70006
4829 Zenith St, Metairie, LA 70001
300 7th Ave #6, Corsicana, TX 75110
(504) 454-6515
Bryan William Franklin
Lilian Y Franklin
Larry Joseph Franklin
Born in 1964
5200 Banks Rd,Fort Worth, TX 76140

Former addresses
1209 Hidden Crk, Little Rock, AR 72212
1010 Glade Rd, Grapevine, TX 76051
3702 Moselle Dr, Arlington, TX 76016
1223 Dan Gould Dr, Arlington, TX 76001
503 Mockingbird Dr, Mansfield, TX 76063
3701 Bordeaux Ct, Arlington, TX 76016
1209 Hidden Crk, Little Rock, AR 72201
5302 Wild West Dr, Arlington, TX 76017
5200 Banks Rd, Everman, TX 76140
4335 Green Acres Cir, Arlington, TX 76017
(817) 516-8330

Former phone numbers
(817) 561-0805
(817) 516-8330
(817) 561-0805
(817) 834-4090
(817) 929-0775
Larry R Franklin
Born in 1930
9563 Weldon Cir #208,Tamarac, FL 33321

Former addresses
9563 Weldon Cir, Ft Lauderdale, FL 33321
9563 Weldon Cir, Fort Lauderdale, FL 33321
9563 Weldon Cir #210, Tamarac, FL 33321
1846 Hammock Blvd #1, Coconut Creek, FL 33063
9563 Weldon Cir #208, Fort Lauderdale, FL 33321
2242 Seagrape Cir, Coconut Creek, FL 33066
9563 Weldon Cir #208-D, Tamarac, FL 33321
1326 Cariann Ln, Glenview, IL 60025
9563 Weldon Cir, Tamarac, FL 33321
9563 Weldon Cir #404, Fort Lauderdale, FL 33321
9563 Weldon Cir #208D, Tamarac, FL 33321
(954) 721-0729

Former phone numbers
(954) 721-0729
(954) 977-0790
Larry Johnson Franklin
Born in 1941
421 Bob White Ln,Shreveport, LA 71106

Former addresses
401 Market St #1400, Shreveport, LA 71101
(318) 797-8316

Former phone numbers
(318) 617-2047
(318) 797-8316
Elizabeth Fry Franklin
Howard Fry Franklin
Lisa Franklin
Lisa Franklin Cargile
Douglas T Franklin
Lawrence Franklin

Associated names
Jr L J Franklin, Larry J Franklin, L J Jr Franklin, L J Franklin, Lawrence Franklin
Larry R Franklin
Born in 1960
60 Coolidge St #5,Taunton, MA 02780

Former addresses
135 Hibbert St #Q, Arlington, MA 02476
335 Hunnewell St, Needham Heights, MA 02494
1248 Mass, Arlington, MA 02174
25 Elm St #10, Foxboro, MA 02035
52 Pleasant St, Lexington, MA 02421
1248 Massachusetts Ave, Arlington, MA 02476
(781) 648-9202
Larry Franklin
Born in 1946
215 Montgomery Dr,Lafayette, LA 70506

Former addresses
4919 Eagle Trail Dr, Houston, TX 77084
(337) 984-7461
Larry Ray Franklin
Born in 1958
8833 Sharon Hills St,Baton Rouge, LA 70811

Former addresses
3304 Weller Ave, Baton Rouge, LA 70805
6050 Ruby Ct, Baton Rouge, LA 70805
10871 Cherry Hill Ave, Baton Rouge, LA 70816
(225) 355-8177

Former phone numbers
(225) 358-3070
(225) 355-7925
(225) 356-7831
(225) 355-0996
(225) 769-3594


Possible e-mails
lfranklin@excelonline.com
Larry D Franklin
Born in 1952
4208 Ironwood Dr,Baker, LA 70714
Marietta C Franklin
Kieland Franklin
Larry Joe Franklin
Born in 1947
2202 Regency Dr,Bessemer, AL 35022

Former addresses
4000 Ave I Ensley, Birmingham, AL 35218
21136 Michelle Dr, Mc Calla, AL 35111
5909 Eastern Valley Rd, Mc Calla, AL 35111
1417 Rayfield Dr, Birmingham, AL 35228
4414 Woodward Rd, Brighton, AL 35020
1811 8th Ave, Bessemer, AL 35020
(205) 382-1655

Former phone numbers
(205) 481-3045
(205) 841-5541
(205) 428-9251


Possible e-mails
larrysrags@worldnet.att.net
Larry Wayne Franklin
Born in 1952
437 9th Ct,Homestead, FL 33030

Former addresses
1525 Leisure, Leisure City, FL 33033
9422 185th Ter, Miami, FL 33157
15251 Leisure Dr, Homestead, FL 33033
(305) 248-8882

Former phone numbers
(305) 247-6725
(305) 248-8882
Franklin Kimberly Ann
Robert S Franklin
Lawrence W Franklin
Brenda G Franklin
Lori Chafin Franklin

Associated names
Larry W Franklin

Donations from Larry Franklin

Name
Address
Occupation
Amount
Recipient
Larry Franklin
Occupation INVESTOR, SELF-EMPLOYED
Amount $2300.00
Recipient Saxby Chambliss (R)
Larry Franklin
Occupation CHAIRMAN, HARTE-HANKS
Amount $1000.00
Recipient Michael McGavick (R)
Larry Franklin
Occupation
Amount $-1000.00
Recipient Marc Flagg (R)
Larry Franklin
2729 BRYDEN CT ALTON IL 62002
Occupation
Amount $250.00
Recipient BEISER, DANIEL V
Larry Franklin
Occupation CEO & CHAIRMAN, HARTE HANKS INC.
Amount $1000.00
Recipient Olympia Snowe (R)
Larry Franklin
Occupation CHAIRMAN, HARTE-HANKS
Amount $1000.00
Recipient Bob Corker (R)
Larry Franklin
2801 Altagate Ct LOUISVILLE KY 40206
Occupation Attorney, Self employed
Amount $2000.00
Recipient John Edwards (D)
Larry Franklin
1416 WILLOW AVE 4B LOUISVILLE KY 40204
Occupation ATTORNEY, FRANKLIN & HANCE
Amount $500.00
Recipient NEAL, GERALD A
Larry Franklin
2801 ALTAGATE CT LOUISVILLE KY 40202
Occupation ATTORNEY, FRANKLIN & HANCE
Amount $1000.00
Recipient GORMAN, CHRIS
Larry Franklin
PO BOX 909 GORE OK 74435
Occupation RETIRED, RETIRED
Amount $25.00
Recipient FALLIN, MARY COPELAND
Larry Franklin
9601 MCALLISTER FREEWAY Ste 610 SAN ANTONIO TX 78216
Occupation CHAIRMAN AND CEO, HARTE-HANKS, INC
Amount $2000.00
Recipient Newt Gingrich (R)
Larry Franklin
1416 WILLOW AVE 4B LOUISVILLE KY 40204
Occupation ATTORNEY, FRANKLIN & HANCE
Amount $1000.00
Recipient JONES II, RAY S
Larry Franklin
Occupation HARTE-HANKS INC, CHAIRMAN
Amount $1000.00
Recipient STRAUS, JOE (COMMITTEE 2)
Larry Franklin
2809 5th St SE MOULTRIE GA 31768
Occupation Owner, Franklin Properties
Amount $1000.00
Recipient Jim Marshall (D)
Larry Franklin
1416 WILLOW AVE APT 4-B LOUISVILLE KY 40204
Occupation ATTORNEY, FRANKLIN AND HANCE
Amount
Recipient
Larry Franklin
Occupation CHAIRMAN, HARTE-HANKS INC
Amount $500.00
Recipient STRAUS, JOE (COMMITTEE 2)
Larry Franklin
Occupation CHAIRMAN, HARTE-HANKS
Amount $1000.00
Recipient Thomas H Kean Jr (R)
Larry Franklin
1416 WILLOW AVE 4B LOUISVILLE KY 40204
Occupation ATTORNEY, FRANKLIN AND HANCE
Amount
Recipient
Larry Franklin
505 W ORMSBY AVE LOUISVILLE KY 40203
Occupation ATTORNEY, FRANKLIN GRAY AND WHITE
Amount $500.00
Recipient ActBlue
Larry Franklin
1416 WILLOW AVE #4B LOUISVILLE KY 40204
Occupation ATTORNEY, FRANKLIN & HONCE, AAL
Amount $1000.00
Recipient CONWAY, JACK
Larry Franklin
PO 269 SAN ANTONIO TX 78291
Occupation Requested, Requested
Amount $1000.00
Recipient Michele Bachmann (R)
Larry Franklin
Occupation HARTE-HANKS INC
Amount $2000.00
Recipient Rick Santorum (R)
Larry Franklin
Occupation PRESIDENT/CEO, FRANKLIN SPORTS
Amount $500.00
Recipient Tom Harkin (D)
Larry Franklin
1416 Willow Ave 4B LOUISVILLE KY 40204
Occupation Attorney, Franklin & Hance
Amount $3500.00
Recipient Kentucky State Dem Central Exec Cmte
Larry Franklin
Occupation PRESIDENT AND CEO, HARTE-HANKS, INC
Amount $500.00
Recipient Sue Lowden (R)
Larry Franklin
Occupation INVESTOR, SELF-EMPLOYED
Amount $2300.00
Recipient Saxby Chambliss (R)
Larry Franklin
PO BOX 909 GORE OK 74435
Occupation RETIRED, RETIRED
Amount $20.00
Recipient FALLIN, MARY COPELAND
Larry Franklin
1416 WILLOW AVE APT 4-B LOUISVILLE KY 40204
Occupation ATTORNEY, FRANKLIN & HANCE
Amount $1000.00
Recipient CONWAY, JACK
Larry Franklin
1416 WILLOW AVE APT 4B LOUISVILLE KY 40204
Occupation ATTORNEY, FRANKLIN & HANLB
Amount $1000.00
Recipient STUMBO, JANET L
Larry Franklin
Occupation
Amount $2000.00
Recipient Mel Martinez (R)
Larry Franklin
Occupation CHAIRMAN AND CEO, HARTE-HANKS, INC
Amount
Recipient
Larry Franklin
1354 Laclede Ave JACKSONVILLE FL 32205
Occupation OWNER, FRANKLIN PROPERTIES
Amount $1000.00
Recipient Jack Kingston (R)
Larry Franklin
Occupation HARTE-HANKS
Amount $2000.00
Recipient John Thune (R)
Larry Franklin
5050 W ORMSBY AVE LOUISVILLE KY 40203
Occupation ATTORNEY, FRANKLIN & HANCE
Amount $1000.00
Recipient HUBBARD, CARROLL
Larry Franklin
Occupation CHAIRMAN, HARTE-HANKS, INC.
Amount $2100.00
Recipient Norm Coleman (R)
Larry Franklin
PO BOX 909 GORE OK 74435
Occupation RETIRED, RETIRED
Amount $10.00
Recipient FALLIN, MARY COPELAND
Larry Franklin
PO 269 SAN ANTONIO TX 78291
Occupation CHAIRMAN & CEO, HARTE-HANKS, INC
Amount $25000.00
Recipient American Crossroads
Larry Franklin
Occupation
Amount $2500.00
Recipient Scott Brown (R)
Larry Franklin
1416 WILLOW AVE 4B LOUISVILLE KY 40204
Occupation ATTORNEY, FRANKLIN & HONCE, AAL
Amount $1000.00
Recipient JOHNSON, RICK
Larry Franklin
PO 269 San Antonio TX 78291
Occupation Retired
Amount $10000.00
Recipient Texas Republican Congressional Cmte

Larry Franklin in Car Registration Database

Name
Address
Phone
Car Model
VIN
Larry Franklin
317 TIMBERLINE RD, KILGORE, TX 75662-7602
(903) 984-0668
Car Model 2008 NISSAN ALTIMA
VIN 1N4BL24EX8C182159
Larry Franklin
2202 Mingee Dr, Hampton, VA 23661-1033
(757) 838-4555
Car Model 2007 CHEVROLET TAHOE
VIN 1GNFK13097R116722
Larry Franklin
5338 Parkside Dr, Charleston, SC 29405-4106
(843) 554-1877
Car Model 2007 SATURN OUTLOOK
VIN 5GZER33767J106719
Larry Franklin
1226 Tribbett Ave, Sharon Hill, PA 19079-2522
(484) 494-1218
Car Model 2007 PONTIAC G6
VIN 1G2ZH35N474275528
Larry Franklin
1707 NE Duchess Dr, Lees Summit, MO 64086-6203
Car Model 2007 PONTIAC G6
VIN 1G2ZG58N074162332
Larry Franklin
24568 LITTLE MACK AVE, ST CLR SHORES, MI 48080-3205
Car Model 2007 DODGE NITRO
VIN 1D8GT58KX7W528601
Larry Franklin
1369 Duck Hill Ranch Rd, Duck Hill, MS 38925-9529
Car Model 2007 BMW 3 SERIES
VIN WBAWV13527PK48807
Larry Franklin
4243 Douglas Dam Rd, Kodak, TN 37764-1219
(865) 933-8830
Car Model 2007 CHEVROLET SILVERADO 1500
VIN 1GCEK14037Z622906
Larry Franklin
4365 Cook Springs Rd, Pell City, AL 35125-4453
(205) 338-5575
Car Model 2007 CHEVROLET TAHOE
VIN 1GNFC13007R340510
Larry Franklin
1707 NE Duchess Dr, Lees Summit, MO 64086-6203
Car Model 2007 CHEVROLET SILVERADO 1500
VIN 3GCEK13Y27G529155
Larry Franklin
112 W Market St, Bickleton, WA 99322-9747
Car Model 2007 CHEVROLET EQUINOX
VIN 2CNDL73F976046165
Larry Franklin
103 Alfred Ct, Yorktown, VA 23693-2656
Car Model 2007 SCION TC
VIN JTKDE167870171160
Larry Franklin
1779 DIXON BRANCH RD, SEVIERVILLE, TN 37876
Car Model 2007 DODGE CARAVAN
VIN 1D4GP25R97B176317
Larry Franklin
246 NESBITT DR, MINA, SD 57451-3007
Car Model 2007 CHEVROLET SILVERADO 1500
VIN 2GCEK19J571668652
Larry Franklin
1080 S Hoagland Blvd Lot 23, Kissimmee, FL 34741-6279
Car Model 2007 FORD F-150
VIN 1FTRF12237NA40032
Larry Franklin
1954 Harvest Way, Middleburg, FL 32068-3636
(904) 406-5636
Car Model 2007 DODGE CHARGER
VIN 2B3KA43R47H685733
Larry Franklin
14801 Royal Oak Dr, Little Rock, AR 72210-3712
(501) 455-4888
Car Model 2007 GMC SIERRA 1500
VIN 2GTEC19JX71625681
Larry Franklin
1411 Fathom Dr, Oxnard, CA 93035-2334
(805) 984-6722
Car Model 2007 GMC SIERRA 2500HD
VIN 1GTHC23667F541079
Larry Franklin
PO Box 494, Creede, CO 81130-0494
(719) 658-2166
Car Model 2007 CHEVROLET SILVERADO 2500HD CLASSIC
VIN 1GCHK23D97F132382
Larry Franklin
514 Orleans Ave, New Iberia, LA 70563-8455
(\N) -
Car Model 2007 DODGE RAM PICKUP 1500
VIN 1D7HA18P97J516391
Larry Franklin
3254 HARDING ST, DEARBORN, MI 48124-3728
Car Model 2007 DODGE NITRO
VIN 1D8GU28K97W527788
Larry Franklin
4721 Ethel Way, Sacramento, CA 95820-5224
Car Model 2008 DODGE AVENGER
VIN 1B3LC76M98N567301
Larry Franklin
110 Creekview Ln, Hampton, VA 23669-1083
(757) 851-7390
Car Model 2007 CHEVROLET CORVETTE
VIN 1G1YY26EX75134899
Larry Franklin
PO Box 826, Crocker, MO 65452-0826
(573) 736-2906
Car Model 2007 DODGE RAM PICKUP 3500
VIN 3D7MX48A77G797358
Larry Franklin
12083 Livery Dr, Jacksonville, FL 32246-0560
Car Model 2007 GMC ACADIA
VIN 1GKER23717J117689

Larry Franklin in Company Registration Database

Name
Company Name
Company Address
Position
Creation Date
Company Status
LARRY D. FRANKLIN
Company FRABAR INVESTMENTS, INC.
573 Deer Trail Lakes Drive , Clarkesville, GA 30523
Position registered agent
Creation Date 1998-05-07
Company Status Active/Compliance
LARRY FRANKLIN
200 CONCORD PLAZA DR #800 , San Antonio TX
Position Director
LARRY FRANKLIN
Company LJL LABORATORIES, INC.
5170 CHEMIN DE VIE , ATLANTA, GA 30342
Position registered agent
Creation Date 2001-09-28
Company Status Automated Administrative dissolution/Revocati
LARRY FRANKLIN
200 CONRAD PLAZA DR STE 800 , San Antonio TX 78216
Position VICE PRESIDENT
LARRY FRANKLIN
Company TRONTEL CORPORATION
10539 JIMENEZ AVE , LAKEVIEW TERRACE, CA 91342
Position registered agent
Creation Date 1985-01-10
Company Status Suspended
LARRY FRANKLIN
Company LARRY FRANKLIN, LTD.
365 LIPPIZAN LANE 365 LIPPIZAN LANE, RENO, NV 89506
Position Secretary
Creation Date 2006-09-27
Company Status Permanently Revoked
LARRY FRANKLIN
5144 CENTRAL AVENUE, ST., PETERSBURG FL 33707
Position PRESIDENT
LARRY D FRANKLIN
Company SUNBELT COMMUNICATIONS, INC.
16451 LOST CABIN 16451 LOST CABIN, SAN ANTONIO, TX 78232
Position President
Creation Date 1978-12-26
Company Status Merge Dissolved
Larry Franklin
16451 LOST CABIN , San Antonio TX
Position VP
Larry G. Franklin
25 Posey St , Savannah, GA 31406
Position registered agent
LARRY FRANKLIN
200 CONCORD PLAZA DR., SAN ANTONIO TX 78216
Position DIRECTOR
LARRY FRANKLIN
17 CAMPANELLI PARKWAY,, STOUGHTON MA 02072
Position SECRETARY
LARRY FRANKLIN
200 CONCORD PLAZA DR , SAN ANTONIO TX 78216
Position Director
LARRY FRANKLIN
62 BISHOP RD.,, SHARON MA
Position TREASURER
LARRY FRANKLIN
3630 SOUTH GEYER ROAD, SUITE 100, ST. LOUIS MO 63127
Position DIRECTOR
LARRY FRANKLIN
9601 MCALLISTER FREEWAY, STE 610 , SAN ANTONIO TX 78216
Position DIRECTOR
LARRY FRANKLIN
96 MONADNOCK RD., CHESTNUT, HILL MA 02167
Position CLERK
Larry E Franklin
9903 FRANKLIN ROAD , Houston TX 77070
Position Director
LARRY FRANKLIN
17 CAMPANELLI PARKWAY,, STOUGHTON MA 02072
Position DIRECTOR
LARRY FRANKLIN
2809 5TH ST SE , MOULTRIE, GA 31788
Position registered agent
LARRY FRANKLIN
Company LARRY FRANKLIN, LTD.
365 LIPPIZAN LANE 365 LIPPIZAN LANE, RENO, NV 89506
Position President
Creation Date 2006-09-27
Company Status Permanently Revoked
LARRY G. FRANKLIN
Company LARRY G. FRANKLIN, INC.
12515 KINGWOOD DR , SAVANNAH, GA 31419
Position registered agent
Creation Date 1978-09-13
Company Status Active/Compliance
Larry Franklin
16451 LOST CABIN , San Antonio TX
Position Director
LARRY FRANKLIN
17 CAMPANELLI PARKWAY,, STOUGHTON MA 02072
Position CEO
LARRY FRANKLIN
85 YARMOUTH RD.,, BROOKLINE MA 02167
Position TREASURER
LARRY FRANKLIN
200 CONCORD PLAZA DR #800 , San Antonio TX
Position VICE PRESIDENT
LARRY L FRANKLIN
2305 CAMARIE , MIDLAND TX 79705
Position DIRECTOR
Larry G. Franklin
25 Posey St , Savannah, GA 31406
Position registered agent
LARRY FRANKLIN
Company CALRENTCO, INCORPORATED
7460 NORTH FIFTH , FRESNO, CA 93710
Position registered agent
Creation Date 1983-06-24
Company Status Dissolved
LARRY FRANKLIN
9601 MCALLISTER FREEWAY, STE 610 , SAN ANTONIO TX 78216
Position PRESIDENT
LARRY FRANKLIN
Company LARRY FRANKLIN, LTD.
365 LIPPIZAN LANE 365 LIPPIZAN LANE, RENO, NV 89506
Position Treasurer
Creation Date 2006-09-27
Company Status Permanently Revoked
LARRY FRANKLIN
85 YARMOUTH RD.,, BROOKLINE MA 02167
Position SECRETARY
LARRY D FRANKLIN
Company SUNBELT COMMUNICATIONS, INC.
16451 LOST CABIN 16451 LOST CABIN, SAN ANTONIO, TX 78232
Position President
Creation Date 1978-12-26
Company Status Merge Dissolved
LARRY FRANKLIN
85 YARMOUTH RD.,, BROOKLINE MA 02167
Position PRESIDENT
LARRY K FRANKLIN
Company HOWARD AND FRANKLIN, INC.
1010 MADRONE 1010 MADRONE, PLACERVILLE, CA 95667
Position Treasurer
Creation Date 1998-03-24
Company Status Dissolved
LARRY FRANKLIN
Position NONE GIVEN - P
Larry Franklin
P O BOX 269 , San Antonio TX 78291
Position VP
Larry Franklin
16451 LOST CABIN , San Antonio TX
Position VP
Larry Franklin
16451 LOST CABIN , San Antonio TX
Position Director
LARRY L FRANKLIN
5903 FROST STREET , HUMBLE TX 77396
Position VICE PRESIDENT
LARRY FRANKLIN
200 CONCORD PLAZA DR , SAN ANTONIO TX 78216
Position VICE PRESIDENT
LARRY K FRANKLIN
Company HOWARD AND FRANKLIN, INC.
PO BOX 1508 PO BOX 1508, SHINGLE SPRINGS, CA 95682
Position President
Creation Date 1998-03-24
Company Status Dissolved
LARRY L FRANKLIN
2305 CAMARIE , MIDLAND TX 79705
Position PRESIDENT
LORI BURNS
Company ELM TREE TOWNHOUSE OWNERS ASSOCIATION
1920 CLAY ST , NAPA, CA 94559
Position registered agent
Creation Date 1984-03-22
Company Status Active
Larry Franklin
200 Concord Plaza Dr. Ste. 800, San Antonio TX 78216
Position Director
LARRY FRANKLIN
1418 GEORGIA HIGHWAY 133 SO. , MOULTRIE, GA 31788
Position registered agent
LEON FICHMAN
Company U.S.C.C. FINANCIAL INC.
CORPORATION SUPPLY SERVICE 548 S. SPRING STREET, SUITE 512, LOS ANGELES, CA 90013
Position registered agent
Creation Date 1985-08-23
Company Status Suspended
LARRY FRANKLIN
5144 CENTRAL AVENUE, ST., PETERSBURG FL 33707
Position TREASURER
LARRY FRANKLIN
9601 MCALLISTER FREEWAY, STE 610 , SAN ANTONIO TX 78216
Position CHIEF EXECUTIVE OFFICER
LARRY FRANKLIN
Company LARRY FRANKLIN PROPERTIES, INC.
2809 5TH ST SE , MOULTRIE, GA 31768
Position registered agent
Creation Date 2006-03-06
Company Status Active/Compliance
Larry E Franklin
9903 FRANKLIN ROAD , Houston TX 77070
Position P
Larry Franklin
P O BOX 269 , San Antonio TX 78291
Position Director
Larry L Franklin
5903 FROST , Humble TX 77396
Position General Partner
Larry Franklin
2809 5th Street, S.E. , Moultrie, GA 31768
Position registered agent
IGOR BIRMAN
Company GOLDEN STATE VETERINARY MEDICAL ASSOCIATION
1029 K ST STE 44 , SACRAMENTO, CA 95814
Position registered agent
Creation Date 2007-09-14
Company Status Suspended
LARRY FRANKLIN
Company AMERICAN CAR CONSULTANTS, INC.
4545 DON MIGUEL DR , LOS ANGELES, CA 90008
Position registered agent
Creation Date 1987-01-22
Company Status Suspended
LARRY FRANKLIN
Company LAZATICAS, INC.
3147 MOYERS RD , SAN PABLO, CA 94806
Position registered agent
Creation Date 2003-01-16
Company Status Suspended
LARRY D. FRANKLIN
Company REMOTE SYSTEM MANAGEMENT & CONSULTING, INC.
8867 SPRINGHURST DRIVE , ELK GROVE, CA 95624
Position registered agent
Creation Date 1997-04-07
Company Status Suspended
LARRY FRANKLIN
Company LARRY FRANKLIN PROPERTIES, INC.
2809 5TH ST SE , MOULTRIE, GA 31768
Position registered agent
Creation Date 2006-03-06
Company Status Active/Compliance
LARRY FRANKLIN
96 MONADNOCK RD., CHESTNUT, HILL MA 02167
Position TREASURER
LARRY FRANKLIN
6710 CLAYTON ROAD , Richmond Heights MO 63117
Position Director
LARRY FRANKLIN
Company LARRY FRANKLIN, LTD.
365 LIPPIZAN LANE 365 LIPPIZAN LANE, RENO, NV 89506
Position Director
Creation Date 2006-09-27
Company Status Permanently Revoked
LARRY FRANKLIN
Company VICTORY BAPTIST CHURCH OF CLARKESVILLE, INC.
152 FRANKLIN ROAD , MOUNT AIRY, GA 30563
Position registered agent
Creation Date 1979-01-29
Company Status Admin. Dissolved
LARRY FRANKLIN
200 CONRAD PLAZA DR STE 800 , San Antonio TX 78216
Position Director
LARRY L FRANKLIN
2305 CAMARIE , MIDLAND TX 79705
Position DIRECTOR
LARRY FRANKLIN
17 CAMPANELLI PARKWAY,, STOUGHTON MA 02072
Position PRESIDENT
LARRY FRANKLIN
62 BISHOP RD.,, SHARON MA
Position SECRETARY
LARRY FRANKLIN
16451 LOS CABIN SAN, ANTONIO TX
Position PRESIDENT
LARRY FRANKLIN
17 CAMPANELLI PARKWAY, STOUGHTON MA 02072
Position TREASURER
LARRY FRANKLIN
1418 GEORGIA HIGHWAY 133 SO. , MOULTRIE, GA 31788
Position registered agent
LARRY K FRANKLIN
Company HOWARD AND FRANKLIN, INC.
PO BOX 1508 PO BOX 1508, SHINGLE SPRINGS, CA 95682
Position President
Creation Date 1998-03-24
Company Status Dissolved
LARRY FRANKLIN
62 BISHOP RD.,, SHARON MA
Position SECRETARY
Larry G. Franklin
25 Posey St , Savannah, GA 31406
Position registered agent
Larry Franklin
200 Concord Plaza Dr. Ste. 800, San Antonio TX 78216
Position Vice-President

Larry Franklin Marketing Data

Name, Address, Phone
Marketing Data
Mr. Larry Franklin
615 Nichol Ave Anderson IN 46016 -1246
(765) 393-1326
Range of new credit: Greater than $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Larry Franklin
2354 Wheeler Hill Rd Columbia KY 42728 -5566
(270) 378-5192
Home owner source: Verified Home Owner
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Larry Franklin
1620 Stanphil Rd Jacksonville AR 72076 -5451
(501) 912-3910
Income - estimated household: $40,000 - $44,999
Estimated net worth: $10,000 - $24,999
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Larry W Franklin
PO Box 494 Creede CO 81130-0494 -0494
(719) 658-2166
Income - estimated household: $40,000 - $44,999
Estimated net worth: $10,000 - $24,999
Range of new credit: $3,001 - $5,000
Education: Completed Graduate School
Ethnic group: Western European
. Larry N Franklin
1711 Pin Oak Pkwy Bowie MD 20721-3073 -3073
Home owner source: Probably Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $250,000 - $499,999
Range of new credit: $3,001 - $5,000
Education: Completed High School
Ethnic group: All African American Ethnic Groups
Mr. Larry R Franklin
1380 Flattail Run Lawrenceville GA 30043 -5655
(678) 640-4399
Home owner source: Verified Home Owner
Income - estimated household: $100,000 - $149,999
Estimated net worth: $100,000 - $249,999
Range of new credit: $1,001 - $3,000
Education: Completed College
Ethnic group: Western European
Mr. Larry Franklin
1971 Us Highway 60 E Salem KY 42078 -9365
(270) 988-3144
Home owner source: Verified Home Owner
Income - estimated household: $15,000 - $19,999
Estimated net worth: $1 - $4,999
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Larry D Franklin
3629 Reel Cir Sacramento CA 95832 -1507
(916) 391-8686
Home owner source: Verified Home Owner
Income - estimated household: $10,000 - $14,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $5,001 - $9,999
Education: Completed College
Ethnic group: Western European
Mr. Larry D Franklin
2400 Emery St Longmont CO 80501 -1105
(303) 682-0599
Home owner source: Verified Home Owner
Income - estimated household: $60,000 - $64,999
Estimated net worth: $100,000 - $249,999
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Larry L Franklin
4380 Anson Dr Jacksonville FL 32246 -6510
bigheadred47@aol.com
Home owner source: Verified Home Owner
Income - estimated household: $45,000 - $49,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 2 Lines
Range of new credit: Greater than $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Larry E Franklin
600 Dupree Rd Dallas GA 30157 -6156
(770) 443-9389
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $3,001 - $5,000
Education: Completed College
Ethnic group: Western European
Mr. Larry A Franklin
610 Ephesus Church Rd Whitesburg GA 30185 -2847
(770) 830-0716
Home owner source: Verified Home Owner
Income - estimated household: $50,000 - $54,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 2 Lines
Range of new credit: $5,001 - $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Larry Franklin
196 N Plains St Gwinn MI 49841 -9121
(906) 346-5790
Home owner source: Highly Likely Home Owner
Income - estimated household: $10,000 - $14,999
Estimated net worth: $50,000 - $99,999
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Larry B Franklin
3200 Cardinal Creek Cir Bentonville AR 72712 -3920
(479) 464-9951
Home owner source: Verified Home Owner
Income - estimated household: $200,000 - $249,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 2 Lines
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Larry Franklin
10463 Ives St Bellflower CA 90706 -4126
(562) 461-9491
Home owner source: Verified Home Owner
Income - estimated household: $40,000 - $44,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $5,001 - $9,999
Education: Completed College
Ethnic group: Western European
Mr. Larry G Franklin
5620 N Saint Louis Ave Loveland CO 80538 -1224
(970) 619-8536
Home owner source: Verified Home Owner
Income - estimated household: $200,000 - $249,999
Estimated net worth: Greater than $499,999
Lines of credit (trade counter): 4 Lines
Range of new credit: $3,001 - $5,000
Education: Completed Graduate School
Ethnic group: Western European
Mr. Larry W Franklin
8596 Se Alabama Pl Hobe Sound FL 33455 -4315
(772) 546-7183
jh0716@aol.com
Home owner source: Highly Likely Home Owner
Income - estimated household: $100,000 - $149,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Larry S Franklin
152 Franklin Rd Mount Airy GA 30563 -2139
(706) 631-8960
larryfranklin@zoominternet.net
Home owner source: Verified Home Owner
Income - estimated household: $10,000 - $14,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $3,001 - $5,000
Education: Completed High School
Ethnic group: Western European
Mr. Larry E Franklin
10741 N Miller Ln Kansas City KS 66109 -4741
(913) 721-1438
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $5,001 - $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Larry L Franklin
1819 E Glen Oaks Dr Wichita KS 67216 -2245
(316) 267-9108
wpf56@hotmail.com
Home owner source: Verified Home Owner
Income - estimated household: $65,000 - $74,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 2 Lines
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Larry V Franklin
2041 S Pattie St Wichita KS 67211 -5136
(316) 265-1243
Home owner source: Verified Home Owner
Income - estimated household: $20,000 - $24,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $5,001 - $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Larry A Franklin
319 Grobmyer Ave Carrollton KY 41008 -9506
(502) 662-0344
larrymindy@aol.com
Home owner source: Verified Home Owner
Income - estimated household: $50,000 - $54,999
Estimated net worth: $100,000 - $249,999
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Larry D Franklin
2649 Old Boonesboro Rd Winchester KY 40391 -9204
(859) 737-3270
delphiafranklin@bellsouth.net
Income - estimated household: $50,000 - $54,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 9+ Lines
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Larry Franklin
6320 County Road 116 Hamel MN 55340 -9642
(763) 478-6049
l4frankie@msn.com
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $3,001 - $5,000
Education: Completed College
Ethnic group: Western European
Mr. Larry B Franklin
7237 E 99th St Kansas City MO 64134 -1704
(816) 767-1649
lawrencefranklin@earthlink.net
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $0 - $100
Education: Completed High School
Ethnic group: All African American Ethnic Groups
Mr. Larry C Franklin
10839 E Avenue S Littlerock CA 93543 -2101
(661) 944-0474
bullie1206@aol.com
Home owner source: Verified Home Owner
Income - estimated household: $55,000 - $59,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $1,001 - $3,000
Education: Completed High School
Ethnic group: Western European
Mr. Larry W Franklin
1340 Parkside Dr Riverside CA 92506 -4720
(951) 780-8099
franklin0152@sbcglobal.net
Home owner source: Verified Home Owner
Income - estimated household: $250,000 +
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 2 Lines
Range of new credit: $1,001 - $3,000
Education: Completed College
Ethnic group: Western European
Mr. Larry M Franklin
2729 Bryden Ct Alton IL 62002 -5775
(618) 463-1222
lmfranklin01@aol.com
Home owner source: Verified Home Owner
Income - estimated household: $100,000 - $149,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 3 Lines
Range of new credit: $5,001 - $9,999
Education: Completed College
Ethnic group: Western European
Mr. Larry D Franklin
14 Forsythia Dr Harwich MA 02645 -1111
(508) 951-6078
franklinkeys@yahoo.com
Home owner source: Verified Home Owner
Income - estimated household: $175,000 - $199,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $3,001 - $5,000
Education: Completed High School
Ethnic group: Western European
Mr. Larry D Franklin
6219 Kyle Ave N Minneapolis MN 55429 -2472
(763) 537-4774
ldpafrank@aol.com
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 9+ Lines
Range of new credit: $3,001 - $5,000
Education: Completed College
Ethnic group: Western European

Larry Franklin Whois Records

Domain
Registrar Data

questrac@aol.com
Create / update date: 15-Mar-2012 02:29:02 UTC / 16-Mar-2013 01:23:27 UTC
FastDomain Inc. (R1455-LROR)
PO Box 363 Westwood New Jersey 07675, UNITED STATES
12015384979
ambitisworking.com
larryfranklin@verizon.net
Whois sever: whois.godaddy.com
Create / update date: 14-jan-2013 / 14-jan-2013
GODADDY.COM, LLC
5 Fairdale Court Silver Spring Maryland 20905, UNITED STATES
clintonchronicle.com
lfranklin@charterinternet.com
Whois sever: whois.godaddy.com
Create / update date: 08-oct-2004 / 09-oct-2013
GODADDY.COM, LLC
513 N Broad St Clinton South Carolina 29325, UNITED STATES
fcchostingservice2.com
larryfranklin@verizon.net
Whois sever: whois.godaddy.com
Create / update date: 18-nov-2008 / 23-nov-2012
GODADDY.COM, LLC
1711 Pin Oak Parkway Bowie Maryland 20721, UNITED STATES
pigeonforgelandforsale.com
sales@oldhamcounty.com
Whois sever: whois.godaddy.com
Create / update date: 24-sep-2010 / 09-oct-2013
GODADDY.COM, LLC
Moultrie, Ga Crestwood Kentucky 40014, UNITED STATES
rbdaycenter.com
LARRY.FRANKLIN@RBDAYCENTER.COM
Whois sever: whois.domainpeople.com
Create / update date: 25-jun-2012 / 20-jun-2013
DOMAINPEOPLE, INC.
226 E. MAIN ST. SENTOBIA MS 38668, UNITED STATES
chrislearningcenter.net
larryfranklin@verizon.net
Whois sever: whois.godaddy.com
Create / update date: 30-oct-2013 / 30-oct-2013
GODADDY.COM, LLC
5 Fairdale Court Silver Spring Maryland 20905, UNITED STATES
3017287435
drlarrywfranklinphdvipservice.com
tuneups@northrock.bm
Whois sever: whois.godaddy.com
Create / update date: 27-sep-2006 / 04-sep-2013
GODADDY.COM, LLC
558 Warwick, Bermuda WKBX Van nuys California 91411, UNITED STATES
14415058854
fcchostingservice1.com
larryfranklin@verizon.net
Whois sever: whois.godaddy.com
Create / update date: 18-nov-2008 / 19-nov-2013
GODADDY.COM, LLC
1711 Pin Oak Parkway Bowie Maryland 20721, UNITED STATES
301 2187789
fl2-r.com
wingnut56@bellsouth.net
Whois sever: whois.register.com
Create / update date: 16-may-2002 / 17-apr-2012
REGISTER.COM, INC.
18524 NW 18th Street Pembroke Pines FL 33029, UNITED STATES
19544506009
larry-franklin.com
j68fc7uh9wb@networksolutionsprivateregistration.com
Whois sever: whois.networksolutions.com
Create / update date: 22-oct-1999 / 18-nov-2013
NETWORK SOLUTIONS, LLC.
PO Box 459 Drums PA 18222, UNITED STATES
5707088780
restoringreason.com
larandede@tds.net
Whois sever: whois.register.com
Create / update date: 25-apr-2012 / 20-oct-2013
REGISTER.COM, INC.
9469 Moen Valley Road Black Earth WI 53515, UNITED STATES
16087674437


People Finder Catalog

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z 


0.021 s.