Brian Hannigan All 178 Facebook Profiles 40Whois Records 30Contacts, Possible Relatives 25Addresses, Phone Numbers 25Marketing Data 22LinkedIn Profiles 20Car Registrations 12US Voter Database 3White House Visitors 1

Brian Hannigan Facebook Profiles

Brian Heineken (guille) facebook profile
Brian Heineken (guille), briangumj
Lives in Brasil Leite, Rio Grande Do Sul, Brazil
Studied at CEDVA
Chief Executive Officer at Turbotec
Brian Hannigan facebook profile
Brian Hannigan
Lives in Frankfort, Illinois
Frankfort, Illinois
Brian Hannigan facebook profile
Brian Hannigan
From Havertown, Pennsylvania
Studied at West Chester University
Geologist at EEI
Brian Hannigan facebook profile
Brian Hannigan, brian.hannigan.182
Lives in Peru, Indiana
Peru, Indiana
Brian Hennigan facebook profile
Brian Hennigan, Brian-Hennigan
Lives in Mahopac, New York
Mahopac, New York
Brian Hannigan facebook profile
Brian Hannigan, brian.hannigan.3
Lives in Newbridge, Kildare, Ireland
Studied Fine Art (Painting) BA (Hons) at NCAD '99
Boss at Artist
Brian Hanigan facebook profile
Brian Hanigan, brian.hanigan.7
From Portugu├ęs
Brian Hanagan facebook profile
Brian Hanagan, brian.hanagan.3
Lives in Philadelphia, Pennsylvania
Laborer at City of Philadelphia Government
Brian Henigan facebook profile
Brian Henigan, brian.henigan
Lives in Farmington, Arkansas
Went to Harleton High School
Harleton High School
Brian Hannigan facebook profile
Brian Hannigan, brian.hannigan.771
Lives in Surrey, British Columbia
Studied at St. Francis Xavier University '93
St. Francis Xavier University
Brian Hannigan facebook profile
Brian Hannigan
Lives in Detroit, Michigan
Detroit, Michigan
Brian Hannigan facebook profile
Brian Hannigan, brian.hannigan.16
Worked at Colgate/Palmolive - KC
From Jersey City, New Jersey
Brian Hannigan facebook profile
Brian Hannigan, brian.hannigan.792
Lives in Easley, South Carolina
Studied at L.I.U./C. W. Post/Adelphi '71
L.I.U./C. W. Post/Adelphi
Brian Heineken facebook profile
Brian Heineken, brian.guillen.5623
Design engineer at Turbotec
Studied at Massachusetts Institute Of Technology (MIT), USA
Works at Queretaro F.C.
Brian Hannigan facebook profile
Brian Hannigan, brian.hannigan.125
Lives in Travelers Rest, South Carolina
Travelers Rest, South Carolina
Brian Hannigan facebook profile
Brian Hannigan
Lives in Capistrano Beach, California
Went to San Clemente High '83
Committee Chair at Relay For Life - San Clemente
Brian Hannigan facebook profile
Brian Hannigan, brian.hannigan.940
St. John Baptist Diocesan High School
Brian Hannigan facebook profile
Brian Hannigan, brian.hannigan.35
Worked at City of Kitchener
Went to Huron Heights Secondary School '72
Huron Heights Secondary School
Brian Hanigan facebook profile
Brian Hanigan
Lives in Clinton, New Jersey
Line Cook at Jockey Hollow Bar & Kitchen
Brian Hannigan facebook profile
Brian Hannigan, brian.hannigan.52
Worked at City of Kitchener
Went to Huron Heights Secondary School
Huron Heights Secondary School
Brian Hannigan facebook profile
Brian Hannigan, brian.hannigan.319
Self-employed
Went to St Benildus College
Works at Self-employed
Brian M. Hannigan facebook profile
Brian M. Hannigan, brian.m.hannigan
Lives in Barrie, Ontario
Former Project Controls Manager at DMC Mining Services
Barrie, Ontario
D Brian Hannigan facebook profile
D Brian Hannigan
Lives in Peru, Indiana
Peru, Indiana
Brian Hannigan facebook profile
Brian Hannigan, Brian-Hannigan
Lives in Clarksboro, New Jersey
Studied at Kutztown University of Pennsylvania
Kutztown University of Pennsylvania
Brian Hennigan facebook profile
Brian Hennigan, brian.hennigan.94
Studied Nothing self education is better people. at moyne college '92
Petrolium Engineer at ALL OVER IRELAND
Brian Hennigan facebook profile
Brian Hennigan
Lives in Hermosa Beach, California
Associate Designer at possible
Brian O' Sullivan facebook profile
Brian O' Sullivan, brian.osullivan.1804
Studied at IT Sligo
IT Sligo
Brian O'Hannigan facebook profile
Brian O'Hannigan
Lives in Dublin, Ireland
Dublin, Ireland
Brian Hennigan facebook profile
Brian Hennigan
UConn
Brian Hannigan facebook profile
Brian Hannigan
Worked at simmons pet food
Studied at Audubon Jr./Sr. High School
Audubon Jr./Sr. High School
Brian O Hannigan facebook profile
Brian O Hannigan, brian.o.hannigan
Lives in Dublin, Ireland
Studied at DIT Kevin Street
Works at SuperValu Bray
Brian Hennigan facebook profile
Brian Hennigan, LIVEONE80
Lives in Staten Island, New York
Went to Somerville High School '97
Somerville High School
Brian H Hannigan facebook profile
Brian H Hannigan, brian.hannigan.12
Lives in Kingston, Massachusetts
Studied at Boston College
Lifeguard at Eel River Beach Club
Brian Hannigan (Banjo Picker) facebook profile
Brian Hannigan (Banjo Picker), brian.hannigan.7798
From Huntsville, Ontario
Brian Hannigan facebook profile
Brian Hannigan
Lives in Dracut, Massachusetts
Mixer Driver at Torromeo Industries, Inc. & Divisions. Kingston Red T Mix Concrete
Brian Hannigan facebook profile
Brian Hannigan, brian.hannigan.923
Studied at Saint Louis University
Saint Louis University
Brian Hannigan facebook profile
Brian Hannigan, brian.hannigan1
Lives in Kinsale, Ireland
Studies Chemical engineering at Queen's University Belfast '18
Queen's University Belfast
Brian Hanegan facebook profile
Brian Hanegan
From Sioux Falls, South Dakota
Studies Studio Saxophone/Pedagogy at North Dakota State University '17
Director of Jazz Studies and Athletic Bands at Augustana University
Brian Hanigan facebook profile
Brian Hanigan, brian.hanigan
Lives in Atlanta, Georgia
Studied Finance at Southern Illinois University Carbondale '83
Practice Manager - Planning and Essbase at Ranzal
Brian Hannigan facebook profile
Brian Hannigan, brian.hannigan.79
From Amsterdam, Netherlands

Brian Hannigan LinkedIn Profiles

Brian Hannigan linkedin profile
Brian Hannigan
Owner at Hann Tech Marketing Links / InspectionNews.net
Information Services
Orange County, California Area
Brian Hannigan linkedin profile
Brian Hannigan
CEO at RateElert, Inc.
Internet
Ann Arbor, Michigan
Brian Hannigan linkedin profile
Brian Hannigan
President at Pacific CoastCom
Telecommunications
Vancouver, Canada Area
Brian Hannigan linkedin profile
Brian Hannigan
Founder and CEO at RateElert.com
Internet
Greater Detroit Area
Brian Hannigan linkedin profile
Brian Hannigan
Government Relations and Communications Consultant
Government Relations
Washington D.C. Metro Area
Brian Hannigan linkedin profile
Brian Hannigan
Mechanical Engineer at SAIC
Information Technology and Services
Providence, Rhode Island Area
Brian Hannigan linkedin profile
Brian Hannigan
Senior Shift Supervisor at Simmons Pet Foods Inc.
Food & Beverages
Greater Philadelphia Area
Brian Hannigan linkedin profile
Brian Hannigan
Controls Engineer at Mestek, Inc.
Mechanical or Industrial Engineering
Springfield, Massachusetts Area
Brian Hannigan linkedin profile
Brian Hannigan
Enterprise Platforms Team Lead at McKesson BPS
Information Technology and Services
Greater Chicago Area
Brian Hannigan linkedin profile
Brian Hannigan
Analyst at BlackRock
Financial Services
Greater Philadelphia Area
Brian Hannigan linkedin profile
Brian Hannigan
Senior Designer at ARKWORK
Design
Greater Philadelphia Area
brian hannigan linkedin profile
brian hannigan
Independent Marketing and Advertising Professional
Marketing and Advertising
Calgary, Canada Area
Brian Hannigan linkedin profile
Brian Hannigan
Geoscience
Oil & Energy
Greater Philadelphia Area
Brian Hannigan linkedin profile
Brian Hannigan
United States
Brian Hannigan linkedin profile
Brian Hannigan
United States
Brian Hannigan linkedin profile
Brian Hannigan
Project Manager at Permasteelisa North America
Construction
Hartford, Connecticut Area
Brian Hannigan linkedin profile
Brian Hannigan
Stagehand at Production Resource Group
Entertainment
Warwick, New York
Brian Hannigan linkedin profile
Brian Hannigan
Attended Southern New Hampshire University
Hooksett, New Hampshire
Brian Hannigan linkedin profile
Brian Hannigan
Owner, Brian Hannigan
Computer Software
Greater New York City Area
Brian Hannigan linkedin profile
Brian Hannigan
Personal Finance Coach
Financial Services
Greater New York City Area

Brian Hannigan in White House Visitors Database

Name
Visit Date
Visitee Name
Appointment Number
Meeting Location
Caller Name
Total Visitors
BRIAN J HANNIGAN
Visit Date 3/16/13 12:00
Visitee Name VISITORS OFFICE
Appointment Number U82607
Meeting Location WH RESIDENCE
Caller Name VISITORS OFFICE
Total Visitors 271

Brian Hannigan in US Voter Database

Name
Address
Phone
E-mail
Party
Brian Hannigan
603 ROSE CT, LISLE, IL, 60532
(630) 774-0510
bhannigan@mchsi.com
Republican
Brian Hannigan
103 AMBER PL, NORTH WALES, PA, 19454
(610) 937-0776
brian.hannigan@aol.com
Brian Hannigan
18 ELISE AVE, DRACUT, MA, 1826
(978) 604-0734
bhannigan@comcast.net
Independent

Brian Hannigan Addresses, Phone Numbers

Name
Address
County
Phone
Brian Hannigan
794 OAK BROOK RIDGE DR APT 153, ROCHESTER HILLS, MI, 48307
OAKLAND
Brian Hannigan
10324 LINUS LN, OAK LAWN, IL, 60453
COOK
(708) 636-1665
Brian Hannigan
2020 NE 62ND ST, FT LAUDERDALE, FL, 33308
BROWARD
Brian Hannigan
18 ELISE AVE, DRACUT, MA, 1826
MIDDLESEX
(978) 452-7063
Brian Hannigan
4849 S AUSTIN AVE, CHICAGO, IL, 60638
COOK
Brian Hannigan
434 W ROSCOE ST, CHICAGO, IL, 60657
COOK
(773) 327-3847
Brian Hannigan
248 REED AVE, WINDSOR LOCKS, CT, 6096
HARTFORD
(860) 370-9402
Brian Hannigan
2926 CALLE GRANDE VIS, SAN CLEMENTE, CA, 92672
ORANGE
Brian Hannigan
12208 W 67TH TER, SHAWNEE, KS, 66216
JOHNSON
Brian Hannigan
248 REED AVE, WINDSOR LOCKS, CT, 6096
HARTFORD
(860) 370-9402
Brian Hannigan
8258 STONEHENGE DR, ORLAND PARK, IL, 60462
COOK
Brian Hannigan
15247 CREEKSIDE DR, OAK FOREST, IL, 60452
COOK
Brian Hannigan
205 MORGAN CT, MANHATTAN, IL, 60442
WILL
Brian Hannigan
200 MICHELLE LN, GROTON, CT, 6340
NEW LONDON
(860) 405-0785
Brian Hannigan
, , ,
Brian Hannigan
180 UNION AVE, LACONIA, NH, 3246
BELKNAP
(603) 524-1706
Brian Hannigan
2020 NE 62ND ST, FORT LAUDERDALE, FL, 33308
BROWARD
Brian Hannigan
305 MICHELLE LN APT 312, GROTON, CT, 6340
NEW LONDON
(860) 405-0785
Brian Hannigan
180 UNION AVE, LACONIA, NH, 3246
BELKNAP
(603) 524-1706
Brian Hannigan
290 MARY WEBB RD, WINDSOR LOCKS, CT, 6096
HARTFORD
(860) 623-9618
Brian Hannigan
172 BLANDFORD RD, CHESTER, MA, 1011
HAMPDEN
(413) 354-7787
Brian Hannigan
290 MARY WEBB RD, WINDSOR LOCKS, CT, 6096
HARTFORD
(860) 623-9618
Brian Hannigan
180 UNION AVE, LACONIA, NH, 3246
BELKNAP
(603) 524-1706
Brian Hannigan
2480 SKILLMAN AVE E, SAINT PAUL, MN, 55109
RAMSEY
(651) 770-0806
Brian Hannigan
173 OLD POST RD, YORK, ME, 3909
YORK
(207) 363-5134

Brian Hannigan addresses, contacts, age, possible relatives

Name
Born in
Address
Contacts
Possible Relatives
Brian J Hannigan
Born in 1962
2 Amherst Ct,Hamburg, NJ 07419

Former addresses
10 Forestdale Rd, Kinnelon, NJ 07405
(973) 827-6926

Former phone numbers
(973) 827-6926
(973) 838-2966


Possible e-mails
bhann@att.net, bhann10868@aol.com
Robt P Hannigan
Kevin G Hannigan
Tracey J Hannigan
Thomas J Hannigan
Michael J Hannigan
Robert Nmi Hannigan
Robert N Hannigan
Margaret P Hannigan
Thomas Michael Smith
Brian Joseph Hannigan
Born in 1952
13705 70th Ave,Village Of Palmetto Bay, FL 33158

Former addresses
Hayes Hill Rd, Otis, MA 01253
14836 Carver Dr, Miami, FL 33176
13705 Farmer Rd, Village Of Palmetto Bay, FL 33158
(305) 255-0474

Former phone numbers
(305) 495-5871
(305) 255-0474
(305) 255-6511
(305) 790-1328


Possible e-mails
bhannigan@aol.com, hannigan@adelphia.net
Wendie K Hannigan
Wendye K Hanningan

Associated names
Joseph B Hannigan
Brian Hannigan
11080 Oberlin,Scottsdale, AZ 85262
Brian Hannigan
Born in 1963
213 5th Ave,Mount Ephraim, NJ 08059

Former addresses
226 Haddon Ave, Collingswood, NJ 08108
117 Chestnut St #D, Audubon, NJ 08106
(856) 931-2213

Former phone numbers
(856) 858-6158
(856) 931-2213
(856) 546-7651
(856) 547-7184
(856) 546-7651


Possible e-mails
marfengib@gmail.com, marfengib@verizon.net
John T Hannigan
Shirley P Hannigan
Leo Thomas Hannigan
Brian Hannigan
455 RR 1 POB,Falls, PA 18615
Brian J Hannigan
Born in 1963
18 Elise Ave,Dracut, MA 01826

Former addresses
491 Methuen St, Dracut, MA 01826
56 Lakeshore Dr, Dracut, MA 01826
(978) 441-0549

Former phone numbers
(978) 604-0734
(978) 452-7063
Allison J Farrellhannigan
James L Hannigan
Jeffrey F Hannigan
Allison Farrell Hannigan
Therese A Hanningan
Kay Hannigan
Matthew B Hannigan
Karen R Hannigan
Karlene P Hannigan
Brian L Hannigan
Born in 1983
62 Main,Florida, NY 10921
Beth A Hannigan
Diane L Hannigan
Brian C Hannigan
14 Whitehill,West Hartford, CT 06117
Thomas J Hannigan
Rita S Hannigan
Brian P Hannigan
Born in 1966
2908 Calle Gaucho,San Clemente, CA 92673
Melissa Hannigan
Brian J Hannigan
Born in 1971
17 Aspen Ct,Monmouth Junction, NJ 08852

Former addresses
17 Aspen Ct, Monmouth Jct, NJ 08852
21 Ashwood Ave, Randolph, NJ 07869
133 Marine Ln, Long Beach Township, NJ 08008
230 Pershing Rd, Clifton, NJ 07013
Kevin P Hannigan
Eugene S Hannigan
Joan F Hannigan
John F Hannigan
Dorothy J Hannigan
Brian J Hannigan
Born in 1968
3900 64th St #66,Saint Petersburg, FL 33709

Former addresses
4435 Hill Ave #A, Toledo, OH 43615
5260 59th Cir #C8, Kenneth City, FL 33709
6772 35th Ave, Saint Petersburg, FL 33710
4435 Hill Ave #H, Toledo, OH 43615
Donna Marie Hannigan
Gerald Jay Hannigan
Donna L Hannigan
Brian Hannigan
2320 Peoria,Phoenix, AZ 85029
Brian J Hannigan
8906 Old Frederick,Ellicott City, MD 21043
Susan M Hannigan
Brian V Hannigan
Born in 1965
2721 8th Ter,Pompano Beach, FL 33064

Former addresses
24 Adams Commons, Yaphank, NY 11980
2963 Windswept Dr #303, Lantana, FL 33462
2020 62nd St, Ft Lauderdale, FL 33308
79 Long Island Ave, Yaphank, NY 11980
2020 62nd St, Fort Lauderdale, FL 33308
78 Harp Ln, Sayville, NY 11782
(954) 560-9871

Former phone numbers
(631) 589-4784
(954) 946-5087


Possible e-mails
vicko1204@aol.com
Rosemarie L Hannigan
Rosemary C Hannigan
Jr Josephl Hannigan
Jos Ljr Hannigan
Joseph L Hannigan
Thomas J Hannigan
Victoria L Hannigan
Joseph L Hannigan
L Hannigan

Associated names
Brian C Hannigan
Brian J Hannigan
353 Fuller,Easley, SC 29640
Brian Hannigan
Born in 1964
201 Ave B,Key West, FL 33040
Brian Hannigan
Born in 1962
1618 Warhawk,Peru, IN 46970

Former addresses
1801 Lancer,Peru, IN 46970
Bridgett Zollner
Ian Hannigan
Pamela Sue Hannigan
Brian K Hannigan
Born in 1964
26 Eleanor Pl,Huntington, NY 11743

Former addresses
38 Grinsted St, Manhasset, NY 11030
1050 McKinley St, Baldwin, NY 11510
(631) 271-1724

Former phone numbers
(631) 271-1724
(516) 528-9816
(631) 786-8462
(516) 546-4993
James F Hannigan
Elissa Melkonian
Joseph P Hannigan
Patricia J Hannigan
Margaret A Hannigan
Brian Hannigan
40 Amherst St #6,Nashua, NH 03064
Brian Hannigan
Born in 1986
120 Eastern,Manhattan, IL 60442
Brian L Hannigan
225 34th,New York, NY 10122

Former addresses
2400 Dulop,Phoenix, AZ 85021
2400 Dunlap,Phoenix, AZ 85021
Brian J Hannigan
Born in 1958
12279 Alabama Pl,Lakewood, CO 80228

Former addresses
6207 Island Crest Way, Mercer Island, WA 98040
430 Zang St, Lakewood, CO 80228
499 Pioneer Ln, Estes Park, CO 80517
2579 Brentwood St, Lakewood, CO 80227
(303) 989-0031

Former phone numbers
(303) 989-2449
Barry Hannigan
Patrick M Hannigan
Trust Hannigan
Melinda A Hannigan
Kathleen Ann Hannigan
Catherine Ann Walker
Brian Hannigan
26 Fairlawn,West Hartford, CT 06119
Thomas J Hannigan
Rita S Hannigan
Brian Hannigan
180 Union,Laconia, NH 03246
Nicole Hannigan
Brian H Hannigan
Born in 1985
200 Michelle,Groton, CT 06340

Former addresses
305 Michelle,Groton, CT 06340
126 Oakland,Trumbull, CT 06611
Gail H Hannigan
Robert G Hannigan
Sriram Han
Katherine J Hannigan

Brian Hannigan in Car Registration Database

Name
Address
Phone
Car Model
VIN
Brian Hannigan
8 Old Oak Rd, Mickleton, NJ 08056-1110
(856) 224-1077
Car Model 2010 HONDA ELEMENT
VIN 5J6YH2H71AL001032
Brian Hannigan
2701 Stuart Ave # A, Richmond, VA 23220-3304
(781) 820-3794
Car Model 2011 NISSAN MURANO
VIN JN8AZ1MW3BW173689
Brian Hannigan
353 Fuller Dr, Easley, SC 29640-6752
(864) 263-7290
Car Model 2011 HONDA RIDGELINE
VIN 5FPYK1F52BB008540
Brian Hannigan
5723 Westbriar Dr, Hilliard, OH 43026-8153
Car Model 2011 KIA SPORTAGE
VIN KNDPB3A24B7126074
Brian Hannigan
2 Amherst Ct, Hamburg, NJ 07419-1335
Car Model 2007 NISSAN XTERRA
VIN 5N1AN08W37C502018
Brian Hannigan
2480 Skillman Ave E, Saint Paul, MN 55109-4050
(651) 770-5376
Car Model 2007 DODGE GRAND CARAVAN
VIN 2D4GP44L67R199113
Brian Hannigan
603 Rose Ct, Lisle, IL 60532-2748
Car Model 2007 GMC YUKON XL
VIN 1GKFK16347J307000
Brian Hannigan
5723 WESTBRIAR DR, HILLIARD, OH 43026-8153
Car Model 2008 PONTIAC SOLSTICE
VIN 1G2MC35B78Y113479
Brian Hannigan
126 Sterling Ct Apt 3, Norfolk, VA 23505-2535
Car Model 2009 DODGE CHALLENGER
VIN 2B3LJ44V29H535588
Brian Hannigan
2 Amherst Ct, Hamburg, NJ 07419-1335
(973) 535-7945
Car Model 2011 ACURA RDX
VIN 5J8TB1H51BA000584
Brian Hannigan
2614 Homestead Dr, Easton, PA 18040-8638
(610) 253-2090
Car Model 2011 CHEVROLET MALIBU
VIN 1G1ZC5E10BF115283
Brian Hannigan
290 Palisado Ave, Windsor, CT 06095-2068
(860) 370-9402
Car Model 2011 HYUNDAI TUCSON
VIN KM8JU3AC8BU194271

Brian Hannigan Marketing Data

Name, Address, Phone
Marketing Data
Mr. Brian K Hannigan
12617 Royal Gorge Ct Mokena IL 60448-1662 -1662
(708) 995-5668
Estimated net worth: $1 - $4,999
Range of new credit: Greater than $9,999
Education: Completed Graduate School
Ethnic group: Western European
Mr. Brian J Hannigan
15247 Creekside Dr Oak Forest IL 60452 APT B-2360
(708) 878-6570
brianhannigan@gmail.com
Estimated net worth: $1 - $4,999
Range of new credit: $101 - $300
Education: Completed High School
Ethnic group: Western European
Mr. Brian L Hannigan
126 Sterling Ct Norfolk VA 23505 APT 3-2535
(757) 226-0750
Income - estimated household: $30,000 - $34,999
Range of new credit: $5,001 - $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Brian Hannigan
3251 Ne 9th Ter Pompano Beach FL 33064 -5352
bhannigan@mail.com
Home owner source: Probably Home Owner
Income - estimated household: $50,000 - $54,999
Estimated net worth: $25,000 - $49,999
Range of new credit: Greater than $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Brian P Hannigan
603 Rose Ct Lisle IL 60532 -2748
(630) 969-7384
beeboo55@aol.com
Income - estimated household: $75,000 - $99,999
Estimated net worth: $100,000 - $249,999
Range of new credit: $3,001 - $5,000
Education: Completed College
Ethnic group: Western European
Mr. Brian J Hannigan
659 W Cornelia Ave Chicago IL 60657 APT 3-2517
(773) 327-3847
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 2 Lines
Range of new credit: $101 - $300
Education: Completed College
Ethnic group: Western European
Mr. Brian J Hannigan
21 Ashwood Ave Randolph NJ 07869 -1303
(973) 366-2567
Home owner source: Verified Home Owner
Income - estimated household: $100,000 - $149,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 4 Lines
Range of new credit: $1,001 - $3,000
Education: Completed Graduate School
Ethnic group: Western European
Mr. Brian Hannigan
26 Eleanor Pl Huntington NY 11743 -1917
(631) 271-1724
bhannigan@hotmail.com
Home owner source: Verified Home Owner
Income - estimated household: $250,000 +
Estimated net worth: $250,000 - $499,999
Range of new credit: Greater than $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Brian D Hannigan
56 Bond St West Babylon NY 11704 -3302
(631) 321-4089
momontherun2x2@aol.com
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $50,000 - $99,999
Range of new credit: $5,001 - $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Brian M Hannigan
290 Palisado Ave Windsor CT 06095 -2068
(860) 640-3060
Home owner source: Verified Home Owner
Income - estimated household: $35,000 - $39,999
Estimated net worth: $25,000 - $49,999
Lines of credit (trade counter): 1 Lines
Range of new credit: Greater than $9,999
Education: Completed College
Ethnic group: Western European
Mr. Brian J Hannigan
10324 Linus Ln Oak Lawn IL 60453 -4708
(708) 636-1665
mlh5840@aol.com
Home owner source: Verified Home Owner
Income - estimated household: $65,000 - $74,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 1 Lines
Range of new credit: Greater than $9,999
Education: Completed College
Ethnic group: Western European
Mr. Brian J Hannigan
217 W 6th St Peru IN 46970 -2041
(765) 472-3178
Home owner source: Verified Home Owner
Income - estimated household: $30,000 - $34,999
Estimated net worth: $5,000 - $9,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $101 - $300
Education: Completed College
Ethnic group: Western European
Mr. Brian K Hannigan
23140 Kissinger Rd Leavenworth KS 66048 -6119
(913) 669-8088
brianhannigan@comcast.net
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 5 Lines
Range of new credit: Greater than $9,999
Education: Completed Graduate School
Ethnic group: Western European
Mr. Brian A Hannigan
4074 Gatesford Circle Dr Troy MI 48085 -3609
(248) 524-1927
rhannigan7787@wowway.com
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: Greater than $499,999
Lines of credit (trade counter): 5 Lines
Range of new credit: Greater than $9,999
Education: Completed College
Ethnic group: Western European
Mr. Brian L Hannigan
2480 Skillman Ave E Saint Paul MN 55109 -4050
(651) 260-1575
Home owner source: Verified Home Owner
Income - estimated household: $100,000 - $149,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 4 Lines
Range of new credit: $1,001 - $3,000
Education: Completed Graduate School
Ethnic group: Western European
Mr. Brian J Hannigan
2 Amherst Ct Hamburg NJ 07419 -1335
(973) 827-6926
bhann10868@ix.netcom.com
Home owner source: Verified Home Owner
Income - estimated household: $35,000 - $39,999
Estimated net worth: $50,000 - $99,999
Lines of credit (trade counter): 9+ Lines
Range of new credit: $5,001 - $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Brian G Hannigan
5723 Westbriar Dr Hilliard OH 43026 -8153
brianhannigan@att.net
Home owner source: Verified Home Owner
Income - estimated household: $250,000 +
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 5 Lines
Range of new credit: $5,001 - $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Brian Hannigan
2614 Homestead Dr Easton PA 18040 -8638
(610) 253-2090
hannigan@planetkc.com
Home owner source: Verified Home Owner
Income - estimated household: $100,000 - $149,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 2 Lines
Range of new credit: Greater than $9,999
Education: Completed Graduate School
Ethnic group: Western European
Mr. Brian H Hannigan
126 Oakland Dr Trumbull CT 06611 -1928
(203) 268-1291
gailing840@hotmail.com
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $250,000 - $499,999
Lines of credit (trade counter): 2 Lines
Range of new credit: Greater than $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Brian N Hannigan
172 Blandford Rd Chester MA 01011 -9602
(413) 354-7787
lela_eternity@yahoo.com
Home owner source: Verified Home Owner
Income - estimated household: $45,000 - $49,999
Estimated net worth: $25,000 - $49,999
Lines of credit (trade counter): 1 Lines
Range of new credit: $3,001 - $5,000
Education: Completed College
Ethnic group: Western European
Mr. Brian J Hannigan
18 Elise Ave Dracut MA 01826 -5040
(978) 604-0734
bhannigan@comcast.net
Home owner source: Verified Home Owner
Income - estimated household: $75,000 - $99,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 4 Lines
Range of new credit: $5,001 - $9,999
Education: Completed High School
Ethnic group: Western European
Mr. Brian P Hannigan
173 Old Post Rd York ME 03909 -5814
(207) 363-5134
pkhplowing@gmail.com
Home owner source: Verified Home Owner
Income - estimated household: $175,000 - $199,999
Estimated net worth: $100,000 - $249,999
Lines of credit (trade counter): 5 Lines
Range of new credit: $101 - $300
Education: Completed College
Ethnic group: Western European

Brian Hannigan Whois Records

Domain
Registrar Data
accessmyreport.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 25-oct-2002 / 01-oct-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
accessyourreport.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 18-nov-2002 / 09-nov-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
albuquerquehomeinspection.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 19-mar-2007 / 08-mar-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
arvadahomeinspection.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 19-mar-2007 / 08-mar-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
brownsvillehomeinspection.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 19-mar-2007 / 08-mar-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
caryhomeinspection.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 19-mar-2007 / 08-mar-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
cloverconsulting.com
BJHannigan@hotmail.com
Whois sever: whois.godaddy.com
Create / update date: 26-apr-2002 / 05-aug-2013
GODADDY.COM, LLC
11252 Kluth Dr. Mokena Illinois 60448, UNITED STATES
coabiz.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 19-may-2012 / 03-may-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
elizabethhomeinspection.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 19-mar-2007 / 08-mar-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
givemethepower.com
brianhannigan68@gmail.com
Whois sever: whois.godaddy.com
Create / update date: 19-sep-2010 / 20-sep-2013
GODADDY.COM, LLC
230 Pershing Road Clifton New Jersey 07013, UNITED STATES
greenbayinspections.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 21-feb-2008 / 23-jan-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
hannigan-insurance.com
support@godaddy.com
Whois sever: whois.godaddy.com
Create / update date: 28-oct-2009 / 29-oct-2013
GODADDY.COM, LLC
c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260, UNITED STATES
hanniganagency.com
support@godaddy.com
Whois sever: whois.godaddy.com
Create / update date: 28-oct-2009 / 29-oct-2013
GODADDY.COM, LLC
c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260, UNITED STATES
home-inspectors-in.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 01-aug-2011 / 04-jul-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
homeinspectionlocator.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 13-oct-2004 / 01-oct-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
homeinspectorlocator.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 27-aug-1999 / 01-aug-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
inspection-services.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 03-dec-2003 / 09-nov-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
inspectioninformation.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 25-oct-2002 / 01-oct-2013
ENOM, INC.
2908 CALLE GAUCHO SAN CLEMENTE 92673, UNITED STATES
inspector-tom.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 07-dec-2010 / 08-nov-2012
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
inspectorsupport.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 30-sep-2005 / 13-sep-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
laredohomeinspection.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 19-mar-2007 / 08-mar-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
newyorkcityhomeinspection.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 19-mar-2007 / 08-mar-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
olathehomeinspection.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 19-mar-2007 / 08-mar-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
phillychimneyfireplaceservice.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 26-aug-2009 / 01-aug-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
property-inspection-services.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 28-dec-1999 / 29-nov-2012
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
ranchocucamongahomeinspection.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 19-mar-2007 / 08-mar-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
referralinspections.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 04-apr-2012 / 08-mar-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
santaanahomeinspection.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 19-mar-2007 / 08-mar-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
vendorsvoice.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 19-jan-2006 / 21-dec-2012
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES
virginiabeachhomeinspection.com
BRIAN@HANNTECH.COM
Whois sever: whois.enom.com
Create / update date: 19-mar-2007 / 08-mar-2013
ENOM, INC.
34473 CALLE CARMELITA CAPISTRANO BEACH CA 92624, UNITED STATES


People Finder Catalog

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z 


0.018 s.